PDB entry 3l2l

View 3l2l on RCSB PDB site
Description: X-ray Crystallographic Analysis of Pig Pancreatic Alpha-Amylase with Limit Dextrin and Oligosaccharide
Class: hydrolase
Keywords: catalytic domain, carbohydrate binding module, Oligosaccharide, limit dextrin, glucose, Carbohydrate metabolism, Glycoprotein, Glycosidase, Metal-binding, Pyrrolidone carboxylic acid, Secreted, HYDROLASE
Deposited on 2009-12-15, released 2010-04-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.119
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pancreatic alpha-amylase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00690 (0-495)
      • see remark 999 (0)
      • see remark 999 (410)
    Domains in SCOPe 2.06: d3l2la1, d3l2la2
  • Heterogens: GLC, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l2lA (A:)
    eyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenivvtnpsrpwwe
    ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
    pgnrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
    dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
    aiqsseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
    nqrghgaggasiltfwdarlykvavgfmlahpygftrvmssyrwarnfvngqdvndwigp
    pnnngvikevtinadttcgndwvcehrwrqirnmvwfrnvvdgqpfanwwdngsnqvafg
    rgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsctgikvyvssdgtaqfsis
    nsaedpfiaihaeskl