PDB entry 3l2g

View 3l2g on RCSB PDB site
Description: Glycocyamine kinase, beta-beta homodimer from marine worm Namalycastis sp., with transition state analog Mg(II)-ADP-NO3-glycocyamine. Part 2.
Class: transferase
Keywords: phosphagen kinase, glycocyamine kinase, transition state analog, Kinase, Transferase
Deposited on 2009-12-15, released 2010-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.197
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2ga1, d3l2ga2
  • Chain 'B':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2gb1, d3l2gb2
  • Chain 'C':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2gc1, d3l2gc2
  • Chain 'D':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2gd1, d3l2gd2
  • Chain 'E':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2ge1, d3l2ge2
  • Chain 'F':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2gf1, d3l2gf2
  • Chain 'G':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2gg1, d3l2gg2
  • Chain 'H':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2gh1, d3l2gh2
  • Chain 'I':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2gi1, d3l2gi2
  • Chain 'J':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2gj1, d3l2gj2
  • Chain 'K':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2gk1, d3l2gk2
  • Chain 'L':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2gl1, d3l2gl2
  • Chain 'M':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2gm1, d3l2gm2
  • Chain 'N':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2gn1, d3l2gn2
  • Chain 'O':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2go1, d3l2go2
  • Chain 'P':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2gp1, d3l2gp2
  • Chain 'Q':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2gq1, d3l2gq2
  • Chain 'R':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2gr1, d3l2gr2
  • Heterogens: NMG, ADP, MG, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l2gA (A:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2gA (A:)
    kfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkk
    tgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggvfedkyvkscrir
    cgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmnekdqeqliedhf
    lfekptgallttsgcardwpdgrgiwhnneknflvwineedhirvismqkggdlkavfsr
    farglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrlaflekhprfdeml
    gklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnlliacdkkleagqs
    iddmipk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l2gB (B:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2gB (B:)
    saiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngv
    tfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdl
    dhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdlag
    kyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwine
    edhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgtvv
    rasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserelvq
    vlvdgvnlliacdkkleagqsiddmipk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3l2gC (C:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2gC (C:)
    kfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkk
    tgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggvfedkyvkscrir
    cgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmnekdqeqliedhf
    lfekptgallttsgcardwpdgrgiwhnneknflvwineedhirvismqkggdlkavfsr
    farglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrlaflekhprfdeml
    gklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnlliacdkkleagqs
    iddmipk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3l2gD (D:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2gD (D:)
    qdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfd
    kciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhn
    klvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyy
    plttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwineedh
    irvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgtvvras
    vhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserelvqvlv
    dgvnlliacdkkleagqsiddmipk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3l2gE (E:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2gE (E:)
    kfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkk
    tgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggvfedkyvkscrir
    cgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmnekdqeqliedhf
    lfekptgallttsgcardwpdgrgiwhnneknflvwineedhirvismqkggdlkavfsr
    farglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrlaflekhprfdeml
    gklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnlliacdkkleagqs
    iddmipk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3l2gF (F:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2gF (F:)
    fvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkci
    qtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklv
    ggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplt
    tmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwineedhirv
    ismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgtvvrasvhl
    rlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgv
    nlliacdkkleagqsiddmipk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3l2gG (G:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2gG (G:)
    kfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkk
    tgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggvfedkyvkscrir
    cgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmnekdqeqliedhf
    lfekptgallttsgcardwpdgrgiwhnneknflvwineedhirvismqkggdlkavfsr
    farglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrlaflekhprfdeml
    gklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnlliacdkkleagqs
    iddmipk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3l2gH (H:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2gH (H:)
    fvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkci
    qtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklv
    ggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplt
    tmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwineedhirv
    ismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgtvvrasvhl
    rlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgv
    nlliacdkkleagqsiddmipk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3l2gI (I:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2gI (I:)
    kfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkk
    tgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggvfedkyvkscrir
    cgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmnekdqeqliedhf
    lfekptgallttsgcardwpdgrgiwhnneknflvwineedhirvismqkggdlkavfsr
    farglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrlaflekhprfdeml
    gklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnlliacdkkleagqs
    iddmipk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3l2gJ (J:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2gJ (J:)
    qdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfd
    kciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhn
    klvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyy
    plttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwineedh
    irvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgtvvras
    vhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserelvqvlv
    dgvnlliacdkkleagqsiddmipk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3l2gK (K:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2gK (K:)
    kfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkk
    tgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggvfedkyvkscrir
    cgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmnekdqeqliedhf
    lfekptgallttsgcardwpdgrgiwhnneknflvwineedhirvismqkggdlkavfsr
    farglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrlaflekhprfdeml
    gklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnlliacdkkleagqs
    iddmipk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3l2gL (L:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2gL (L:)
    vknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciq
    tgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvg
    gvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyypltt
    mnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwineedhirvi
    smqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlr
    laflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvn
    lliacdkkleagqsiddmipk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3l2gM (M:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2gM (M:)
    kfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkk
    tgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggvfedkyvkscrir
    cgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmnekdqeqliedhf
    lfekptgallttsgcardwpdgrgiwhnneknflvwineedhirvismqkggdlkavfsr
    farglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrlaflekhprfdeml
    gklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnlliacdkkleagqs
    iddmipk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3l2gN (N:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2gN (N:)
    fvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkci
    qtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklv
    ggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplt
    tmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwineedhirv
    ismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgtvvrasvhl
    rlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgv
    nlliacdkkleagqsiddmipk
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3l2gO (O:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2gO (O:)
    kfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkk
    tgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggvfedkyvkscrir
    cgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmnekdqeqliedhf
    lfekptgallttsgcardwpdgrgiwhnneknflvwineedhirvismqkggdlkavfsr
    farglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrlaflekhprfdeml
    gklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnlliacdkkleagqs
    iddmipk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3l2gP (P:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2gP (P:)
    fvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkci
    qtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklv
    ggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplt
    tmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwineedhirv
    ismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgtvvrasvhl
    rlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgv
    nlliacdkkleagqsiddmipk
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3l2gQ (Q:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2gQ (Q:)
    fkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkkt
    gcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggvfedkyvkscrirc
    grsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmnekdqeqliedhfl
    fekptgallttsgcardwpdgrgiwhnneknflvwineedhirvismqkggdlkavfsrf
    arglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrlaflekhprfdemlg
    klrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnlliacdkkleagqsi
    ddmipk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3l2gR (R:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2gR (R:)
    vknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciq
    tgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvg
    gvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyypltt
    mnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwineedhirvi
    smqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlr
    laflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvn
    lliacdkkleagqsiddmipk