PDB entry 3l2f

View 3l2f on RCSB PDB site
Description: Glycocyamine kinase, beta-beta homodimer from marine worm Namalycastis sp., with transition state analog Mg(II)-ADP-NO3-glycocyamine. Part 1.
Class: transferase
Keywords: phosphagen kinase, glycocyamine kinase, transition state analog, Kinase, Transferase
Deposited on 2009-12-15, released 2010-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.197
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2fa1, d3l2fa2
  • Chain 'B':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2fb1, d3l2fb2
  • Chain 'C':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2fc1, d3l2fc2
  • Chain 'D':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2fd1, d3l2fd2
  • Chain 'E':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2fe1, d3l2fe2
  • Chain 'F':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2ff1, d3l2ff2
  • Chain 'G':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2fg1, d3l2fg2
  • Chain 'H':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2fh1, d3l2fh2
  • Chain 'I':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2fi1, d3l2fi2
  • Chain 'J':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2fj1, d3l2fj2
  • Chain 'K':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2fk1, d3l2fk2
  • Chain 'L':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2fl1, d3l2fl2
  • Chain 'M':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2fm1, d3l2fm2
  • Chain 'N':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2fn1, d3l2fn2
  • Chain 'O':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2fo1, d3l2fo2
  • Chain 'P':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2fp1, d3l2fp2
  • Chain 'Q':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2fq1, d3l2fq2
  • Chain 'R':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2fr1, d3l2fr2
  • Heterogens: NMG, ADP, MG, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l2fA (A:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2fA (A:)
    fkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkkt
    gcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggvfedkyvkscrirc
    grsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmnekdqeqliedhfl
    fekptgallttsgcardwpdgrgiwhnneknflvwineedhirvismqkggdlkavfsrf
    arglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrlaflekhprfdemlg
    klrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnlliacdkkleagqsi
    ddmipk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l2fB (B:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2fB (B:)
    aiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvt
    fdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdld
    hnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdlagk
    yyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwinee
    dhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgtvvr
    asvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserelvqv
    lvdgvnlliacdkkleagqsiddmipk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3l2fC (C:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2fC (C:)
    kfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkk
    tgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggvfedkyvkscrir
    cgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmnekdqeqliedhf
    lfekptgallttsgcardwpdgrgiwhnneknflvwineedhirvismqkggdlkavfsr
    farglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrlaflekhprfdeml
    gklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnlliacdkkleagqs
    iddmipk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3l2fD (D:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2fD (D:)
    fvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkci
    qtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklv
    ggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplt
    tmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwineedhirv
    ismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgtvvrasvhl
    rlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgv
    nlliacdkkleagqsiddmipk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3l2fE (E:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2fE (E:)
    kfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkk
    tgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggvfedkyvkscrir
    cgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmnekdqeqliedhf
    lfekptgallttsgcardwpdgrgiwhnneknflvwineedhirvismqkggdlkavfsr
    farglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrlaflekhprfdeml
    gklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnlliacdkkleagqs
    iddmipk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3l2fF (F:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2fF (F:)
    qdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfd
    kciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhn
    klvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyy
    plttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwineedh
    irvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgtvvras
    vhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserelvqvlv
    dgvnlliacdkkleagqsiddmipk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3l2fG (G:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2fG (G:)
    kfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkk
    tgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggvfedkyvkscrir
    cgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmnekdqeqliedhf
    lfekptgallttsgcardwpdgrgiwhnneknflvwineedhirvismqkggdlkavfsr
    farglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrlaflekhprfdeml
    gklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnlliacdkkleagqs
    iddmipk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3l2fH (H:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2fH (H:)
    dyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdk
    ciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnk
    lvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyp
    lttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwineedhi
    rvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgtvvrasv
    hlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserelvqvlvd
    gvnlliacdkkleagqsiddmipk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3l2fI (I:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2fI (I:)
    fkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkkt
    gcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggvfedkyvkscrirc
    grsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmnekdqeqliedhfl
    fekptgallttsgcardwpdgrgiwhnneknflvwineedhirvismqkggdlkavfsrf
    arglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrlaflekhprfdemlg
    klrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnlliacdkkleagqsi
    ddmipk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3l2fJ (J:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2fJ (J:)
    qdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfd
    kciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhn
    klvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyy
    plttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwineedh
    irvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgtvvras
    vhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserelvqvlv
    dgvnlliacdkkleagqsiddmipk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3l2fK (K:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2fK (K:)
    kfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkk
    tgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggvfedkyvkscrir
    cgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmnekdqeqliedhf
    lfekptgallttsgcardwpdgrgiwhnneknflvwineedhirvismqkggdlkavfsr
    farglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrlaflekhprfdeml
    gklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnlliacdkkleagqs
    iddmipk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3l2fL (L:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2fL (L:)
    dyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdk
    ciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnk
    lvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyp
    lttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwineedhi
    rvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgtvvrasv
    hlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserelvqvlvd
    gvnlliacdkkleagqsiddmipk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3l2fM (M:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2fM (M:)
    kfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkk
    tgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggvfedkyvkscrir
    cgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmnekdqeqliedhf
    lfekptgallttsgcardwpdgrgiwhnneknflvwineedhirvismqkggdlkavfsr
    farglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrlaflekhprfdeml
    gklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnlliacdkkleagqs
    iddmipk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3l2fN (N:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2fN (N:)
    fvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkci
    qtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklv
    ggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplt
    tmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwineedhirv
    ismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgtvvrasvhl
    rlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgv
    nlliacdkkleagqsiddmipk
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3l2fO (O:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2fO (O:)
    fkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkkt
    gcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggvfedkyvkscrirc
    grsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmnekdqeqliedhfl
    fekptgallttsgcardwpdgrgiwhnneknflvwineedhirvismqkggdlkavfsrf
    arglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrlaflekhprfdemlg
    klrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnlliacdkkleagqsi
    ddmipk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3l2fP (P:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2fP (P:)
    vknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciq
    tgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvg
    gvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyypltt
    mnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwineedhirvi
    smqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlr
    laflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvn
    lliacdkkleagqsiddmipk
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3l2fQ (Q:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2fQ (Q:)
    fkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkkt
    gcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggvfedkyvkscrirc
    grsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmnekdqeqliedhfl
    fekptgallttsgcardwpdgrgiwhnneknflvwineedhirvismqkggdlkavfsrf
    arglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrlaflekhprfdemlg
    klrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnlliacdkkleagqsi
    ddmipk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3l2fR (R:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2fR (R:)
    nrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtg
    vdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggv
    fedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmn
    ekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwineedhirvism
    qkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrla
    flekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnll
    iacdkkleagqsiddmipk