PDB entry 3l2d

View 3l2d on RCSB PDB site
Description: Glycocyamine kinase, beta-beta homodimer from marine worm Namalycastis sp.
Class: transferase
Keywords: phosphagen kinase, glycocyamine kinase, Kinase, Transferase
Deposited on 2009-12-15, released 2010-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.197
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2da1, d3l2da2
  • Chain 'B':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2db1, d3l2db2
  • Chain 'C':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2dc1, d3l2dc2
  • Chain 'D':
    Compound: Glycocyamine kinase beta chain
    Species: Namalycastis sp. ST01 [TaxId:243920]
    Gene: GK-beta, GK_beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l2dd1, d3l2dd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l2dA (A:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2dA (A:)
    kfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkk
    tgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggvfedkyvkscrir
    cgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmnekdqeqliedhf
    lfekptgallttsgcardwpdgrgiwhnneknflvwineedhirvismqkggdlkavfsr
    farglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrlaflekhprfdeml
    gklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnlliacdkkleagqs
    iddmipk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l2dB (B:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2dB (B:)
    nrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtg
    vdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggv
    fedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmn
    ekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwineedhirvism
    qkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrla
    flekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnll
    iacdkkleagqsiddmipk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3l2dC (C:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2dC (C:)
    kfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkk
    tgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggvfedkyvkscrir
    cgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmnekdqeqliedhf
    lfekptgallttsgcardwpdgrgiwhnneknflvwineedhirvismqkggdlkavfsr
    farglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrlaflekhprfdeml
    gklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnlliacdkkleagqs
    iddmipk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3l2dD (D:)
    mgsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpn
    gvtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpap
    dldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdl
    agkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwi
    needhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgt
    vvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserel
    vqvlvdgvnlliacdkkleagqsiddmipk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l2dD (D:)
    nrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtg
    vdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkpsdkhpapdldhnklvggv
    fedkyvkscrircgrsvkgvclppamsraerrlvekvvsdalgglkgdlagkyyplttmn
    ekdqeqliedhflfekptgallttsgcardwpdgrgiwhnneknflvwineedhirvism
    qkggdlkavfsrfarglleverlmkecghglmhndrlgyictcptnmgtvvrasvhlrla
    flekhprfdemlgklrlgkrgtggesslatdstydisnwarlgkserelvqvlvdgvnll
    iacdkkleagqsiddmipk