PDB entry 3l1c

View 3l1c on RCSB PDB site
Description: Kinesin-14 Protein Ncd, T436S Mutant
Class: motor protein
Keywords: kinesin ncd, ATP-binding, MOTOR PROTEIN
Deposited on 2009-12-11, released 2010-08-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.238
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-14 Ncd
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: ncd, CA(ND), CG7831
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20480 (1-End)
      • expression tag (0)
      • engineered mutation (144)
    Domains in SCOPe 2.03: d3l1ca_
  • Chain 'B':
    Compound: Kinesin-14 Ncd
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: ncd, CA(ND), CG7831
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20480 (1-382)
      • expression tag (0)
      • engineered mutation (144)
    Domains in SCOPe 2.03: d3l1cb_
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l1cA (A:)
    mhaalstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirv
    fcrirppleseenrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdi
    femvspliqsaldgynicifaygqsgsgktytmdgvpesvgviprtvdllfdsirgyrnl
    gweyeikatfleiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhl
    mhtakmnratastagnerssrshavtkleligrhaekqeisvgsinlvdlagsespktst
    rmtetkninrslseltnvilallqkqdhipyrnsklthllmpslggnsktlmfinvspfq
    dcfqesvkslrfaasvnsckmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l1cA (A:)
    mhaalstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirv
    fcrirppleseenrmcctwtyhdestvelqsidagqqifsfdqvfhplssqsdifemvsp
    liqsaldgynicifaygqsgsgktytmdgvpesvgviprtvdllfdsirgyrnlgweyei
    katfleiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhlmhtakm
    nsrshavtkleligrhaekqeisvgsinlvdlagsespktsninrslseltnvilallqk
    qdhipyrnsklthllmpslggnsktlmfinvspfqdcfqesvkslrfaasvnsck
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l1cB (B:)
    mhaalstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirv
    fcrirppleseenrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdi
    femvspliqsaldgynicifaygqsgsgktytmdgvpesvgviprtvdllfdsirgyrnl
    gweyeikatfleiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhl
    mhtakmnratastagnerssrshavtkleligrhaekqeisvgsinlvdlagsespktst
    rmtetkninrslseltnvilallqkqdhipyrnsklthllmpslggnsktlmfinvspfq
    dcfqesvkslrfaasvnsckmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l1cB (B:)
    mhaalstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirv
    fcrirppleseenrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdi
    femvspliqsaldgynicifaygqsgsgktytmdgvpesvgviprtvdllfdsirweyei
    katfleiynevlydllsiteetvldpnhlrhlmhtakmnrrssrshavtkleligrhaei
    svgsinlvdlagsespnrslseltnvilallqkqdhipyrnsklthllmpslggnsktlm
    finvspfqdcfqesvkslrfaasvnsckmtk