PDB entry 3l18

View 3l18 on RCSB PDB site
Description: Ton1285, an Intracellular Protease from Thermococcus onnurineus NA1
Class: hydrolase
Keywords: GATase1_PfpI_like, Protease, HYDROLASE
Deposited on 2009-12-11, released 2010-12-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.163
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Intracellular protease I
    Species: Thermococcus onnurineus [TaxId:523850]
    Gene: intracellular protease I
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6YXG0 (2-167)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d3l18a1, d3l18a2
  • Chain 'B':
    Compound: Intracellular protease I
    Species: Thermococcus onnurineus [TaxId:523850]
    Gene: intracellular protease I
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6YXG0 (2-167)
      • expression tag (1)
    Domains in SCOPe 2.06: d3l18b1, d3l18b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l18A (A:)
    asmkvlflsadgfedleliyplhrikeeghevyvasfqrgkitgkhgysvnvdltfeevd
    pdefdalvlpggkapeivrlnekavmitrrmfeddkpvasichgpqilisakvlkgrrgt
    stitirddvinagaewidaevvvdgnwvssrhpgdlyawmrefvkllh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l18B (B:)
    asmkvlflsadgfedleliyplhrikeeghevyvasfqrgkitgkhgysvnvdltfeevd
    pdefdalvlpggkapeivrlnekavmitrrmfeddkpvasichgpqilisakvlkgrrgt
    stitirddvinagaewidaevvvdgnwvssrhpgdlyawmrefvkllh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l18B (B:)
    smkvlflsadgfedleliyplhrikeeghevyvasfqrgkitgkhgysvnvdltfeevdp
    defdalvlpggkapeivrlnekavmitrrmfeddkpvasichgpqilisakvlkgrrgts
    titirddvinagaewidaevvvdgnwvssrhpgdlyawmrefvkllh