PDB entry 3l10

View 3l10 on RCSB PDB site
Description: Structure of split monoubiquitinated PCNA with ubiquitin in position one
Class: replication
Keywords: Replication, DNA damage, DNA repair, DNA replication, DNA-binding, Isopeptide bond, Nucleus, Ubl conjugation
Deposited on 2009-12-10, released 2010-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: POL30, YBR0811, YBR088C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3l10a1, d3l10a2
  • Chain 'B':
    Compound: Monoubiquitinated Proliferating cell nuclear antigen
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: POL30, Pol30 & UBI1, YBR0811, YBR088C
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3l10A (A:)
hhhhhhmleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigv
eafqeyrcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaey
slklmdidadflkieelqydstlslpssefskivrdlsqlsdsinimit

    Sequence, based on observed residues (ATOM records): (download) 
    >3l10A (A:)
mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
idadflkieelqydstlslpssefskivrdlsqlsdsinimit

  • Chain 'B':
    No sequence available.