PDB entry 3l0r

View 3l0r on RCSB PDB site
Description: Crystal Structure of Salivary Cystatin from the Soft Tick Ornithodoros moubata
Class: hydrolase inhibitor
Keywords: soft tick, cystatin, Protease inhibitor, Thiol protease inhibitor, HYDROLASE INHIBITOR
Deposited on 2009-12-10, released 2010-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-30, with a file datestamp of 2010-06-25.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.189
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystatin-2
    Species: ORNITHODOROS MOUBATA [TaxId:6938]
    Gene: OmC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6QD55 (Start-108)
      • expression tag (109)
    Domains in SCOPe 2.07: d3l0ra1, d3l0ra2
  • Chain 'B':
    Compound: Cystatin-2
    Species: ORNITHODOROS MOUBATA [TaxId:6938]
    Gene: OmC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6QD55 (Start-108)
      • expression tag (109)
    Domains in SCOPe 2.07: d3l0rb1, d3l0rb2
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l0rA (A:)
    tsipggwtrqdptearflelahfatssqtegrefydtvvtvkevetqvvagmnykltiei
    spsvckigevqysaeqcvpkdaqqkstcvaviyhvpwqnqksvtsyrcehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l0rA (A:)
    ipggwtrqdptearflelahfatssqtegrefydtvvtvkevetqvvagmnykltieisp
    svckigevqysaeqcvpkdaqqkstcvaviyhvpwqnqksvtsyrceh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l0rB (B:)
    tsipggwtrqdptearflelahfatssqtegrefydtvvtvkevetqvvagmnykltiei
    spsvckigevqysaeqcvpkdaqqkstcvaviyhvpwqnqksvtsyrcehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l0rB (B:)
    ipggwtrqdptearflelahfatssqtegrefydtvvtvkevetqvvagmnykltieisp
    svckigevqysaeqcvpkdaqqkstcvaviyhvpwqnqksvtsyrceh