PDB entry 3l07

View 3l07 on RCSB PDB site
Description: Methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein folD from Francisella tularensis.
Class: Oxidoreductase,Hydrolase
Keywords: structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase, methenyltetrahydrofolate cyclohydrolase, bifunctional protein, Amino-acid biosynthesis, Histidine biosynthesis, Hydrolase, Methionine biosynthesis, Multifunctional enzyme, NADP, One-carbon metabolism, Oxidoreductase, Purine biosynthesis, Center for Structural Genomics of Infectious Diseases, CSGID, Oxidoreductase,Hydrolase
Deposited on 2009-12-09, released 2009-12-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.168
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein folD
    Species: Francisella tularensis [TaxId:177416]
    Gene: folD, FTW_1287
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4IYR4 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3l07a1, d3l07a2, d3l07a3
  • Chain 'B':
    Compound: Bifunctional protein folD
    Species: Francisella tularensis [TaxId:177416]
    Gene: folD, FTW_1287
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4IYR4 (3-284)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d3l07b1, d3l07b2, d3l07b3
  • Heterogens: PO4, IMD, EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l07A (A:)
    snamilidgkslskdlkerlatqvqeykhhtaitpklvaiivgndpasktyvaskekaca
    qvgidsqvitlpehttesellelidqlnndssvhailvqlplpahinknnviysikpekd
    vdgfhptnvgrlqlrdkkclesctpkgimtmlreygiktegayavvvgasnvvgkpvsql
    llnakatvttchrfttdlkshttkadilivavgkpnfitadmvkegavvidvginhvdgk
    ivgdvdfaavkdkvaaitpvpggvgpmtitellyntfqcaqelnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l07A (A:)
    amilidgkslskdlkerlatqvqeykhhtaitpklvaiivgndpasktyvaskekacaqv
    gidsqvitlpehttesellelidqlnndssvhailvqlplpahinknnviysikpekdvd
    gfhptnvgrlqlrdkkclesctpkgimtmlreygiktegayavvvgasnvvgkpvsqlll
    nakatvttchrfttdlkshttkadilivavgkpnfitadmvkegavvidvginhvdgkiv
    gdvdfaavkdkvaaitpvpggvgpmtitellyntfqcaqeln
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l07B (B:)
    snamilidgkslskdlkerlatqvqeykhhtaitpklvaiivgndpasktyvaskekaca
    qvgidsqvitlpehttesellelidqlnndssvhailvqlplpahinknnviysikpekd
    vdgfhptnvgrlqlrdkkclesctpkgimtmlreygiktegayavvvgasnvvgkpvsql
    llnakatvttchrfttdlkshttkadilivavgkpnfitadmvkegavvidvginhvdgk
    ivgdvdfaavkdkvaaitpvpggvgpmtitellyntfqcaqelnr