PDB entry 3kzv

View 3kzv on RCSB PDB site
Description: The crystal structure of a cytoplasmic protein with unknown function from Saccharomyces cerevisiae
Class: oxidoreductase
Keywords: cytoplasmic protein, unknown function, structural genomics, PSI, MCSG, Protein Structure Initiative, Midwest Center for Structural Genomics, OXIDOREDUCTASE
Deposited on 2009-12-08, released 2010-03-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized oxidoreductase YIR035C
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: GI:6322226, YIR035C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3kzva_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kzvA (A:)
    mgkvilvtgvsrgigksivdvlfsldkdtvvygvarseaplkklkekygdrffyvvgdit
    edsvlkqlvnaavkghgkidslvanagvlepvqnvneidvnawkklydinffsivslvgi
    alpelkktngnvvfvssdacnmyfsswgaygsskaalnhfamtlaneerqvkaiavapgi
    vdtdmqvnirenvgpssmsaeqlkmfrglkennqlldssvpatvyaklalhgipdgvngq
    ylsyndpaladfmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kzvA (A:)
    gkvilvtgvsrgigksivdvlfsldkdtvvygvarseaplkklkekygdrffyvvgdite
    dsvlkqlvnaavkghgkidslvanagvlepvqnvneidvnawkklydinffsivslvgia
    lpelkktngnvvfvssdacnmyfsswgaygsskaalnhfamtlaneerqvkaiavapgiv
    dtdmqvnirenvgpssmsaeqlkmfrglkennssvpatvyaklalhgipdgvngqylsyn
    dpaladfmp