PDB entry 3kz7

View 3kz7 on RCSB PDB site
Description: C-terminal domain of Murine FKBP25 rapamycin complex
Class: isomerase/inhibitor
Keywords: FKPB PPiase RAPAMYCIN, Isomerase, Nucleus, Phosphoprotein, Rotamase, ISOMERASE-INHIBITOR complex
Deposited on 2009-12-08, released 2010-12-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-20, with a file datestamp of 2014-08-15.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.177
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FK506-binding protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: FKBP25, FKBP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kz7a_
  • Heterogens: RAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kz7A (A:)
    egppkytksilkkgdktnfpkkgdvvhcwytgtlpdgtvfdtniqtsskkkknakplsfk
    vgvgkvirgwdealltmskgekarleiepewaygkkgqpdakippntklifevelvdid