PDB entry 3kz7

View 3kz7 on RCSB PDB site
Description: C-terminal domain of Murine FKBP25 rapamycin complex
Class: isomerase/inhibitor
Keywords: FKPB PPiase RAPAMYCIN, Isomerase, Nucleus, Phosphoprotein, Rotamase, ISOMERASE-INHIBITOR complex
Deposited on 2009-12-08, released 2010-12-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.177
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: FK506-binding protein 3
  Species: Mus musculus [TaxId:10090]
  Gene: FKBP25, FKBP3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q62446 (0-118)
  Domains in SCOPe 2.04: d3kz7a_
• Heterogens: RAP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3kz7A (A:)
  egppkytksilkkgdktnfpkkgdvvhcwytgtlpdgtvfdtniqtsskkkknakplsfk
  vgvgkvirgwdealltmskgekarleiepewaygkkgqpdakippntklifevelvdid