PDB entry 3kyy

View 3kyy on RCSB PDB site
Description: Joint Xray/neutron crystal structure determination of H-labeled perdeuterated rubredoxin at 295K
Class: electron transport
Keywords: joint x-ray neutron refinement, Electron transport, Iron, Metal-binding, Transport
Deposited on 2009-12-07, released 2010-04-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-09-14, with a file datestamp of 2011-09-09.
Experiment type: XRAYNEUT
Resolution: 1.1 Å
R-factor: 0.145
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: RUB, PF1282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3kyya_
  • Heterogens: FE, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kyyA (A:)
    makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled