PDB entry 3kyp

View 3kyp on RCSB PDB site
Description: Crystal structure of Nucleosome assembly protein S (PfNapS) from Plasmodium falciparum
Class: chaperone
Keywords: nucleosome assembly protein, histone recognition, CHAPERONE
Deposited on 2009-12-07, released 2010-06-02
Made obsolete by 5x7v on 2017-03-15

The last revision prior to the SCOPe 2.02 freeze date was dated 2010-06-02, with a file datestamp of 2010-05-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.285
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nucleosome assembly protein
  Species: Plasmodium falciparum [TaxId:5833]
  Gene: B7
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y010 (0-End)
• Chain 'B':
  Compound: Nucleosome assembly protein
  Species: Plasmodium falciparum [TaxId:5833]
  Gene: B7
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y010 (0-End)
• Chain 'C':
  Compound: Nucleosome assembly protein
  Species: Plasmodium falciparum [TaxId:5833]
  Gene: B7
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y010 (0-End)
• Chain 'D':
  Compound: Nucleosome assembly protein
  Species: Plasmodium falciparum [TaxId:5833]
  Gene: B7
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y010 (0-End)
• Chain 'E':
  Compound: Nucleosome assembly protein
  Species: Plasmodium falciparum [TaxId:5833]
  Gene: B7
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y010 (0-End)
• Chain 'F':
  Compound: Nucleosome assembly protein
  Species: Plasmodium falciparum [TaxId:5833]
  Gene: B7
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y010
  Domains in SCOPe 2.02: d3kypf_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  Sequence, based on SEQRES records: (download)
  

  >3kypF (F:)
  fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
  alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
  ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
  whnplsyylglee
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3kypF (F:)
  mqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhpa
  lsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvkvvectr
  ikwkegknpiakwsifewfttdelqdkpdvgelirreiwhnplsyyl