PDB entry 3kyk

View 3kyk on RCSB PDB site
Description: Crystal structure of li33 Igg1 Fab
Class: immune system
Keywords: antibody, IMMUNE SYSTEM
Deposited on 2009-12-06, released 2010-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Heavy Chain Li33 IgG1
    Species: Homo sapiens [TaxId:9606]
    Gene: Heavy chain Li33
    Database cross-references and differences (RAF-indexed):
    • PDB 3KYK (0-End)
  • Chain 'L':
    Compound: Light Chain Li33 IgG1
    Species: Homo sapiens [TaxId:9606]
    Gene: Light chain Li33
    Database cross-references and differences (RAF-indexed):
    • PDB 3KYK (0-End)
    Domains in SCOPe 2.07: d3kykl1, d3kykl2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3kykL (L:)
    diqmtqspgtlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgteftltisslqsedfavyycqqydkwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kykL (L:)
    diqmtqspgtlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgteftltisslqsedfavyycqqydkwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr