PDB entry 3kyd
View 3kyd on RCSB PDB site
Description: Human SUMO E1~SUMO1-AMP tetrahedral intermediate mimic
Class: ligase
Keywords: E1, SUMO, UBIQUITIN, THIOESTER, ADENYLATION, INHIBITOR, TETRAHEDRAL INTERMEDIATE, Ligase, Nucleus, Phosphoprotein, Ubl conjugation pathway, ATP-binding, Nucleotide-binding, Isopeptide bond, Membrane
Deposited on
2009-12-05, released
2010-02-16
The last revision prior to the SCOPe 2.02 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.23
AEROSPACI score: 0.27
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: SUMO-activating enzyme subunit 1
Species: Homo sapiens [TaxId:9606]
Gene: AOS1, SAE1, SUA1, UBLE1A
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: SUMO-activating enzyme subunit 2
Species: Homo sapiens [TaxId:9606]
Gene: HRIHFB2115, SAE2, UBA2, UBLE1B
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Small ubiquitin-related modifier 1
Species: Homo sapiens [TaxId:9606]
Gene: OK/SW-cl.43, SMT3C, SMT3H3, SUMO1, UBL1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d3kydd_ - Heterogens: EDO, ZN, VMX, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'D':
Sequence, based on SEQRES records: (download)
>3kydD (D:)
mgsshhhhhhssglvprshmsdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmt
thlkklkesycqrqgvpmnslrflfegqriadnhtpkelgmeeedvievyqeqcg
Sequence, based on observed residues (ATOM records): (download)
>3kydD (D:)
eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqcg