PDB entry 3kyc

View 3kyc on RCSB PDB site
Description: Human SUMO E1 complex with a SUMO1-AMP mimic
Class: ligase
Keywords: E1, SUMO, UBIQUITIN, THIOESTER, ADENYLATION, INHIBITOR, ACYL-ADENYLATE INTERMEDIATE, Acetylation, Ligase, Nucleus, Phosphoprotein, Ubl conjugation pathway, ATP-binding, Nucleotide-binding, Polymorphism, Cytoplasm, Isopeptide bond, Membrane
Deposited on 2009-12-05, released 2010-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SUMO-activating enzyme subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: AOS1, SAE1, SUA1, UBLE1A
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: SUMO-activating enzyme subunit 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HRIHFB2115, SAE2, UBA2, UBLE1B
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Gene: OK/SW-cl.43, SMT3C, SMT3H3, SUMO1, UBL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165 (Start-96)
      • engineered (94)
    Domains in SCOPe 2.07: d3kycd_
  • Heterogens: ZN, JZU, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3kycD (D:)
    msdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmn
    slrflfegqriadnhtpkelgmeeedvievyqeqcgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kycD (D:)
    geyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpk
    elgmeeedvievyqeqcgg