PDB entry 3kxz

View 3kxz on RCSB PDB site
Description: The complex crystal structure of LCK with a probe molecule w259
Class: Transferase
Keywords: LCK, Acetylation, ATP-binding, Cell membrane, Chromosomal rearrangement, Cytoplasm, Disease mutation, Host-virus interaction, Kinase, Lipoprotein, Membrane, Myristate, Nucleotide-binding, Palmitate, Phosphoprotein, Polymorphism, Proto-oncogene, Transferase, Tyrosine-protein kinase, Structural Genomics, Protein Structure Factory, PSF
Deposited on 2009-12-04, released 2010-06-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-06-23, with a file datestamp of 2010-06-18.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.192
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kxza_
  • Heterogens: SO4, CA, 925, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kxzA (A:)
    gsqtqkpqkpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmsp
    daflaeanlmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinkll
    dmaaqiaegmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakf
    pikwtapeainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrp
    dncpeelyqlmrlcwkerpedrptfdylrsvledfftategqyqpqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kxzA (A:)
    wevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaeanlmkqlqh
    qrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmafiee
    rnyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtapeainygtf
    tiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeelyqlmrlcw
    kerpedrptfdylrsvledfftat