PDB entry 3kxq

View 3kxq on RCSB PDB site
Description: Crystal structure of triosephosphate isomerase from bartonella henselae at 1.6A resolution
Class: isomerase
Keywords: SSGCID, NIH, NIAID, SBRI, UW, TRIOSEPHOSPHATE ISOMERASE, Gluconeogenesis, Glycolysis, Pentose shunt, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, ISOMERASE
Deposited on 2009-12-03, released 2009-12-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.156
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Bartonella henselae [TaxId:38323]
    Gene: tpiA, BH05680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3kxqa_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Bartonella henselae [TaxId:38323]
    Gene: tpiA, BH05680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3kxqb_
  • Heterogens: NO3, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kxqA (A:)
    mahhhhhhmgtleaqtqgpgsmspnirpfiagnwkmngtgeslgelraiaagissdlgrl
    fealicvpatllsrafdilggenillggqnchfddygpytgdisafmlkeagashviigh
    serrtvyqesdaivrakvqaawraglvalicvgetleerksnkvldvltrqlegslpdga
    taeniiiayepvwavgtgntatsadvaevhafihhkmhsrfgdegakirllyggsvkpsn
    afellstahvngaliggaslkaidflticdvyrkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kxqA (A:)
    irpfiagnwkmngtgeslgelraiaagisrlfealicvpatllsrafdilggenillggq
    nchfddygpytgdisafmlkeagashviighserrtvyqesdaivrakvqaawraglval
    icvgetleerksnkvldvltrqlegslpdgataeniiiayepvwtsadvaevhafihhkm
    hsrfgdegakirllyggsvkpsnafellstahvngaliggaslkaidflticdvyrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kxqB (B:)
    mahhhhhhmgtleaqtqgpgsmspnirpfiagnwkmngtgeslgelraiaagissdlgrl
    fealicvpatllsrafdilggenillggqnchfddygpytgdisafmlkeagashviigh
    serrtvyqesdaivrakvqaawraglvalicvgetleerksnkvldvltrqlegslpdga
    taeniiiayepvwavgtgntatsadvaevhafihhkmhsrfgdegakirllyggsvkpsn
    afellstahvngaliggaslkaidflticdvyrkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kxqB (B:)
    irpfiagnwkmngtgeslgelraiaagisfealicvpatllsrafdilggenillggqnc
    hfddygpytgdisafmlkeagashviighserrtvyqesdaivrakvqaawraglvalic
    vgetleerksnkvldvltrqlegslpdgataeniiiayepvwaatsadvaevhafihhkm
    hsrfgdegakirllyggsvkpsnafellstahvngaliggaslkaidflticdvyrk