SCOPe 2.06: Structural Classification of Proteins

PDB entry 3kxp

View 3kxp on RCSB PDB site
Description: Crystal Structure of E-2-(Acetamidomethylene)succinate Hydrolase
Class: hydrolase
Keywords: alpha/beta hydrolase, PLP degradation, E-2-(acetamidomethylene)succinate, Hydrolase
Deposited on 2009-12-03, released 2010-02-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.204
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
Species: Mesorhizobium loti [TaxId:381]
Gene: 5331
Database cross-references and differences (RAF-indexed):
- Uniprot Q988D4 (Start-313)
Domains in SCOPe 2.06: d3kxpa_
Chain 'B':
Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
Species: Mesorhizobium loti [TaxId:381]
Gene: 5331
Database cross-references and differences (RAF-indexed):
- Uniprot Q988D4 (Start-313)
Domains in SCOPe 2.06: d3kxpb_
Chain 'C':
Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
Species: Mesorhizobium loti [TaxId:381]
Gene: 5331
Database cross-references and differences (RAF-indexed):
- Uniprot Q988D4 (Start-313)
Domains in SCOPe 2.06: d3kxpc_
Chain 'D':
Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
Species: Mesorhizobium loti [TaxId:381]
Gene: 5331
Database cross-references and differences (RAF-indexed):
- Uniprot Q988D4 (Start-313)
Domains in SCOPe 2.06: d3kxpd_
Chain 'E':
Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
Species: Mesorhizobium loti [TaxId:381]
Gene: 5331
Database cross-references and differences (RAF-indexed):
- Uniprot Q988D4 (Start-313)
Domains in SCOPe 2.06: d3kxpe_
Chain 'F':
Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
Species: Mesorhizobium loti [TaxId:381]
Gene: 5331
Database cross-references and differences (RAF-indexed):
- Uniprot Q988D4 (Start-313)
Domains in SCOPe 2.06: d3kxpf_
Chain 'G':
Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
Species: Mesorhizobium loti [TaxId:381]
Gene: 5331
Database cross-references and differences (RAF-indexed):
- Uniprot Q988D4 (Start-313)
Domains in SCOPe 2.06: d3kxpg_
Chain 'H':
Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
Species: Mesorhizobium loti [TaxId:381]
Gene: 5331
Database cross-references and differences (RAF-indexed):
- Uniprot Q988D4 (Start-313)
Domains in SCOPe 2.06: d3kxph_
Chain 'I':
Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
Species: Mesorhizobium loti [TaxId:381]
Gene: 5331
Database cross-references and differences (RAF-indexed):
- Uniprot Q988D4 (Start-313)
Domains in SCOPe 2.06: d3kxpi_
Chain 'J':
Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
Species: Mesorhizobium loti [TaxId:381]
Gene: 5331
Database cross-references and differences (RAF-indexed):
- Uniprot Q988D4 (Start-313)
Domains in SCOPe 2.06: d3kxpj_
Chain 'K':
Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
Species: Mesorhizobium loti [TaxId:381]
Gene: 5331
Database cross-references and differences (RAF-indexed):
- Uniprot Q988D4 (Start-313)
Domains in SCOPe 2.06: d3kxpk_
Chain 'L':
Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
Species: Mesorhizobium loti [TaxId:381]
Gene: 5331
Database cross-references and differences (RAF-indexed):
- Uniprot Q988D4 (Start-313)
Domains in SCOPe 2.06: d3kxpl_
Heterogens: CL, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3kxpA (A:)
mgshhhhhhditslykkagsaaavleenlyfggsftmdmaadiasdhfisrrvdigritl
nvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghglsdkpetgyeandy
addiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaidftpyietealdale
arvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgglrplassaamaqta
rglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpvvvvpgadhyvnevs
peitlkaitnfida