PDB entry 3kxp

View 3kxp on RCSB PDB site
Description: Crystal Structure of E-2-(Acetamidomethylene)succinate Hydrolase
Class: hydrolase
Keywords: alpha/beta hydrolase, PLP degradation, E-2-(acetamidomethylene)succinate, Hydrolase
Deposited on 2009-12-03, released 2010-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
    Species: Mesorhizobium loti [TaxId:381]
    Gene: 5331
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kxpa_
  • Chain 'B':
    Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
    Species: Mesorhizobium loti [TaxId:381]
    Gene: 5331
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kxpb_
  • Chain 'C':
    Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
    Species: Mesorhizobium loti [TaxId:381]
    Gene: 5331
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kxpc_
  • Chain 'D':
    Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
    Species: Mesorhizobium loti [TaxId:381]
    Gene: 5331
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kxpd_
  • Chain 'E':
    Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
    Species: Mesorhizobium loti [TaxId:381]
    Gene: 5331
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kxpe_
  • Chain 'F':
    Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
    Species: Mesorhizobium loti [TaxId:381]
    Gene: 5331
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kxpf_
  • Chain 'G':
    Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
    Species: Mesorhizobium loti [TaxId:381]
    Gene: 5331
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kxpg_
  • Chain 'H':
    Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
    Species: Mesorhizobium loti [TaxId:381]
    Gene: 5331
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kxph_
  • Chain 'I':
    Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
    Species: Mesorhizobium loti [TaxId:381]
    Gene: 5331
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kxpi_
  • Chain 'J':
    Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
    Species: Mesorhizobium loti [TaxId:381]
    Gene: 5331
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kxpj_
  • Chain 'K':
    Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
    Species: Mesorhizobium loti [TaxId:381]
    Gene: 5331
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kxpk_
  • Chain 'L':
    Compound: Alpha-(N-acetylaminomethylene)succinic acid hydrolase
    Species: Mesorhizobium loti [TaxId:381]
    Gene: 5331
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kxpl_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kxpA (A:)
    mgshhhhhhditslykkagsaaavleenlyfggsftmdmaadiasdhfisrrvdigritl
    nvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghglsdkpetgyeandy
    addiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaidftpyietealdale
    arvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgglrplassaamaqta
    rglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpvvvvpgadhyvnevs
    peitlkaitnfida
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kxpA (A:)
    hfisrrvdigritlnvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghg
    lsdkpetgyeandyaddiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaid
    ftpyietealdalearvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgg
    lrplassaamaqtarglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpv
    vvvpgadhyvnevspeitlkaitnfida
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kxpB (B:)
    mgshhhhhhditslykkagsaaavleenlyfggsftmdmaadiasdhfisrrvdigritl
    nvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghglsdkpetgyeandy
    addiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaidftpyietealdale
    arvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgglrplassaamaqta
    rglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpvvvvpgadhyvnevs
    peitlkaitnfida
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kxpB (B:)
    hfisrrvdigritlnvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghg
    lsdkpetgyeandyaddiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaid
    ftpyietealdalearvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgg
    lrplassaamaqtarglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpv
    vvvpgadhyvnevspeitlkaitnfida
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3kxpC (C:)
    mgshhhhhhditslykkagsaaavleenlyfggsftmdmaadiasdhfisrrvdigritl
    nvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghglsdkpetgyeandy
    addiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaidftpyietealdale
    arvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgglrplassaamaqta
    rglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpvvvvpgadhyvnevs
    peitlkaitnfida
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kxpC (C:)
    hfisrrvdigritlnvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghg
    lsdkpetgyeandyaddiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaid
    ftpyietealdalearvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgg
    lrplassaamaqtarglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpv
    vvvpgadhyvnevspeitlkaitnfida
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3kxpD (D:)
    mgshhhhhhditslykkagsaaavleenlyfggsftmdmaadiasdhfisrrvdigritl
    nvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghglsdkpetgyeandy
    addiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaidftpyietealdale
    arvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgglrplassaamaqta
    rglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpvvvvpgadhyvnevs
    peitlkaitnfida
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kxpD (D:)
    hfisrrvdigritlnvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghg
    lsdkpetgyeandyaddiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaid
    ftpyietealdalearvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgg
    lrplassaamaqtarglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpv
    vvvpgadhyvnevspeitlkaitnfida
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3kxpE (E:)
    mgshhhhhhditslykkagsaaavleenlyfggsftmdmaadiasdhfisrrvdigritl
    nvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghglsdkpetgyeandy
    addiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaidftpyietealdale
    arvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgglrplassaamaqta
    rglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpvvvvpgadhyvnevs
    peitlkaitnfida
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kxpE (E:)
    hfisrrvdigritlnvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghg
    lsdkpetgyeandyaddiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaid
    ftpyietealdalearvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgg
    lrplassaamaqtarglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpv
    vvvpgadhyvnevspeitlkaitnfida
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3kxpF (F:)
    mgshhhhhhditslykkagsaaavleenlyfggsftmdmaadiasdhfisrrvdigritl
    nvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghglsdkpetgyeandy
    addiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaidftpyietealdale
    arvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgglrplassaamaqta
    rglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpvvvvpgadhyvnevs
    peitlkaitnfida
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kxpF (F:)
    hfisrrvdigritlnvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghg
    lsdkpetgyeandyaddiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaid
    ftpyietealdalearvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgg
    lrplassaamaqtarglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpv
    vvvpgadhyvnevspeitlkaitnfida
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3kxpG (G:)
    mgshhhhhhditslykkagsaaavleenlyfggsftmdmaadiasdhfisrrvdigritl
    nvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghglsdkpetgyeandy
    addiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaidftpyietealdale
    arvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgglrplassaamaqta
    rglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpvvvvpgadhyvnevs
    peitlkaitnfida
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kxpG (G:)
    hfisrrvdigritlnvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghg
    lsdkpetgyeandyaddiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaid
    ftpyietealdalearvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgg
    lrplassaamaqtarglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpv
    vvvpgadhyvnevspeitlkaitnfida
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3kxpH (H:)
    mgshhhhhhditslykkagsaaavleenlyfggsftmdmaadiasdhfisrrvdigritl
    nvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghglsdkpetgyeandy
    addiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaidftpyietealdale
    arvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgglrplassaamaqta
    rglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpvvvvpgadhyvnevs
    peitlkaitnfida
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kxpH (H:)
    hfisrrvdigritlnvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghg
    lsdkpetgyeandyaddiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaid
    ftpyietealdalearvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgg
    lrplassaamaqtarglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpv
    vvvpgadhyvnevspeitlkaitnfida
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3kxpI (I:)
    mgshhhhhhditslykkagsaaavleenlyfggsftmdmaadiasdhfisrrvdigritl
    nvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghglsdkpetgyeandy
    addiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaidftpyietealdale
    arvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgglrplassaamaqta
    rglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpvvvvpgadhyvnevs
    peitlkaitnfida
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kxpI (I:)
    hfisrrvdigritlnvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghg
    lsdkpetgyeandyaddiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaid
    ftpyietealdalearvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgg
    lrplassaamaqtarglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpv
    vvvpgadhyvnevspeitlkaitnfida
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3kxpJ (J:)
    mgshhhhhhditslykkagsaaavleenlyfggsftmdmaadiasdhfisrrvdigritl
    nvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghglsdkpetgyeandy
    addiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaidftpyietealdale
    arvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgglrplassaamaqta
    rglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpvvvvpgadhyvnevs
    peitlkaitnfida
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kxpJ (J:)
    hfisrrvdigritlnvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghg
    lsdkpetgyeandyaddiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaid
    ftpyietealdalearvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgg
    lrplassaamaqtarglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpv
    vvvpgadhyvnevspeitlkaitnfida
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3kxpK (K:)
    mgshhhhhhditslykkagsaaavleenlyfggsftmdmaadiasdhfisrrvdigritl
    nvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghglsdkpetgyeandy
    addiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaidftpyietealdale
    arvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgglrplassaamaqta
    rglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpvvvvpgadhyvnevs
    peitlkaitnfida
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kxpK (K:)
    hfisrrvdigritlnvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghg
    lsdkpetgyeandyaddiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaid
    ftpyietealdalearvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgg
    lrplassaamaqtarglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpv
    vvvpgadhyvnevspeitlkaitnfida
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3kxpL (L:)
    mgshhhhhhditslykkagsaaavleenlyfggsftmdmaadiasdhfisrrvdigritl
    nvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghglsdkpetgyeandy
    addiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaidftpyietealdale
    arvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgglrplassaamaqta
    rglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpvvvvpgadhyvnevs
    peitlkaitnfida
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kxpL (L:)
    hfisrrvdigritlnvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghg
    lsdkpetgyeandyaddiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaid
    ftpyietealdalearvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgg
    lrplassaamaqtarglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpv
    vvvpgadhyvnevspeitlkaitnfida