PDB entry 3kxo

View 3kxo on RCSB PDB site
Description: An orally active inhibitor bound at the active site of HPGDS
Class: isomerase
Keywords: H-PGDS, PGDS, HPGDS, Fatty acid biosynthesis, Isomerase, Lipid synthesis, Prostaglandin biosynthesis
Deposited on 2009-12-03, released 2010-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione-requiring prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: PTGDS2, PGDS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kxoa1, d3kxoa2
  • Chain 'B':
    Compound: glutathione-requiring prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: PTGDS2, PGDS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kxob1, d3kxob2
  • Heterogens: GSH, KXO, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kxoA (A:)
    gshmpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevd
    gltlhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfn
    elltynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtl
    rkkvqaipavanwikrrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kxoA (A:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kxoB (B:)
    gshmpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevd
    gltlhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfn
    elltynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtl
    rkkvqaipavanwikrrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kxoB (B:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl