PDB entry 3kxc

View 3kxc on RCSB PDB site
Description: Mutant transport protein
Class: transport protein
Keywords: heterodimer, Endoplasmic reticulum, ER-Golgi transport, Golgi apparatus, Lipoprotein, Palmitate, Transport, TRANSPORT PROTEIN
Deposited on 2009-12-02, released 2010-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-07-07, with a file datestamp of 2010-07-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trafficking protein particle complex subunit 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43617
      • engineered mutation (81)
    Domains in SCOPe 2.07: d3kxca_
  • Chain 'C':
    Compound: trafficking protein particle complex subunit 6b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3kxcA (A:)
mgsshhhhhhsqdpmsrqanrgteskkmsselftltygalvtqlckdyendedvnkqldk
mgfnigvrliedflarsnvgrahdfretadviakvafkmylgitpsitnwspagdefsli
lennplvdfvelpdnhssliysnllcgvlrgalemvqmaveakfvqdtlkgdgvteirmr
firriednlpagee

    Sequence, based on observed residues (ATOM records): (download) 
    >3kxcA (A:)
selftltygalvtqlckdyendedvnkqldkmgfnigvrliedflarsnvgrahdfreta
dviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhssliysnllcgvl
rgalemvqmaveakfvqdtlkgdgvteirmrfirri

  • Chain 'C':
    No sequence available.