PDB entry 3kwd

View 3kwd on RCSB PDB site
Description: Inactive truncation of the beta-carboxysomal gamma-Carbonic Anhydrase, CcmM, form 1
Class: lyase, protein binding, photosynthesis
Keywords: left-handed beta helix, gamma carbonic anhydrase, disulfide bond dependent activity, carboxysome, LYASE, PROTEIN BINDING, PHOTOSYNTHESIS
Deposited on 2009-12-01, released 2010-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.133
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbon dioxide concentrating mechanism protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: ccmM, tll0944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kwda_
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kwdA (A:)
    mgsshhhhhhssglvprgshmavqsyaapptpwsrdlaepeiaptayvhsfsnligdvri
    kdyvhiapgtsiradegtpfhigsrtniqdgvvihglqqgrvigddgqeysvwigdnvsi
    thmalihgpayigdgcfigfrstvfnarvgagcvvmmhvliqdveippgkyvpsgmvitt
    qqqadrlpnveesdihfaqhvvgineallsgyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kwdA (A:)
    laepeiaptayvhsfsnligdvrikdyvhiapgtsiradegtpfhigsrtniqdgvvihg
    lqqgrvigddgqeysvwigdnvsithmalihgpayigdgcfigfrstvfnarvgagcvvm
    mhvliqdveippgkyvpsgmvittqqqadrlpnveesdihfaqhvv