PDB entry 3kwc

View 3kwc on RCSB PDB site
Description: Oxidized, active structure of the beta-carboxysomal gamma-Carbonic Anhydrase, CcmM
Class: lyase, protein binding, photosynthesis
Keywords: left-handed beta helix, gamma carbonic anhydrase, disulfide bond dependent activity, carboxysome, LYASE, PROTEIN BINDING, PHOTOSYNTHESIS
Deposited on 2009-12-01, released 2010-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbon dioxide concentrating mechanism protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: ccmM, tll0944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kwca_
  • Chain 'B':
    Compound: Carbon dioxide concentrating mechanism protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: ccmM, tll0944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kwcb_
  • Chain 'C':
    Compound: Carbon dioxide concentrating mechanism protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: ccmM, tll0944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kwcc_
  • Chain 'D':
    Compound: Carbon dioxide concentrating mechanism protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: ccmM, tll0944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kwcd_
  • Chain 'E':
    Compound: Carbon dioxide concentrating mechanism protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: ccmM, tll0944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kwce_
  • Chain 'F':
    Compound: Carbon dioxide concentrating mechanism protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: ccmM, tll0944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kwcf_
  • Heterogens: IPA, ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kwcA (A:)
    mgsshhhhhhssglvprgshmavqsyaapptpwsrdlaepeiaptayvhsfsnligdvri
    kdyvhiapgtsiradegtpfhigsrtniqdgvvihglqqgrvigddgqeysvwigdnvsi
    thmalihgpayigdgcfigfrstvfnarvgagcvvmmhvliqdveippgkyvpsgmvitt
    qqqadrlpnveesdihfaqhvvgineallsgyqcaeniaciapirnelq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kwcA (A:)
    qsyaapptpwsrdlaepeiaptayvhsfsnligdvrikdyvhiapgtsiradegtpfhig
    srtniqdgvvihglqqgrvigddgqeysvwigdnvsithmalihgpayigdgcfigfrst
    vfnarvgagcvvmmhvliqdveippgkyvpsgmvittqqqadrlpnveesdihfaqhvvg
    ineallsgyqcaeniaciapirnel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kwcB (B:)
    mgsshhhhhhssglvprgshmavqsyaapptpwsrdlaepeiaptayvhsfsnligdvri
    kdyvhiapgtsiradegtpfhigsrtniqdgvvihglqqgrvigddgqeysvwigdnvsi
    thmalihgpayigdgcfigfrstvfnarvgagcvvmmhvliqdveippgkyvpsgmvitt
    qqqadrlpnveesdihfaqhvvgineallsgyqcaeniaciapirnelq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kwcB (B:)
    qsyaapptpwsrdlaepeiaptayvhsfsnligdvrikdyvhiapgtsiradegtpfhig
    srtniqdgvvihglqqgrvigddgqeysvwigdnvsithmalihgpayigdgcfigfrst
    vfnarvgagcvvmmhvliqdveippgkyvpsgmvittqqqadrlpnveesdihfaqhvvg
    ineallsgyqcaeniaciapirne
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3kwcC (C:)
    mgsshhhhhhssglvprgshmavqsyaapptpwsrdlaepeiaptayvhsfsnligdvri
    kdyvhiapgtsiradegtpfhigsrtniqdgvvihglqqgrvigddgqeysvwigdnvsi
    thmalihgpayigdgcfigfrstvfnarvgagcvvmmhvliqdveippgkyvpsgmvitt
    qqqadrlpnveesdihfaqhvvgineallsgyqcaeniaciapirnelq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kwcC (C:)
    qsyaapptpwsrdlaepeiaptayvhsfsnligdvrikdyvhiapgtsiradegtpfhig
    srtniqdgvvihglqqgrvigddgqeysvwigdnvsithmalihgpayigdgcfigfrst
    vfnarvgagcvvmmhvliqdveippgkyvpsgmvittqqqadrlpnveesdihfaqhvvg
    ineallsgyqcaeniaciapirnel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3kwcD (D:)
    mgsshhhhhhssglvprgshmavqsyaapptpwsrdlaepeiaptayvhsfsnligdvri
    kdyvhiapgtsiradegtpfhigsrtniqdgvvihglqqgrvigddgqeysvwigdnvsi
    thmalihgpayigdgcfigfrstvfnarvgagcvvmmhvliqdveippgkyvpsgmvitt
    qqqadrlpnveesdihfaqhvvgineallsgyqcaeniaciapirnelq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kwcD (D:)
    qsyaapptpwsrdlaepeiaptayvhsfsnligdvrikdyvhiapgtsiradegtpfhig
    srtniqdgvvihglqqgrvigddgqeysvwigdnvsithmalihgpayigdgcfigfrst
    vfnarvgagcvvmmhvliqdveippgkyvpsgmvittqqqadrlpnveesdihfaqhvvg
    ineallsgyqcaeniaciapirnel
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3kwcE (E:)
    mgsshhhhhhssglvprgshmavqsyaapptpwsrdlaepeiaptayvhsfsnligdvri
    kdyvhiapgtsiradegtpfhigsrtniqdgvvihglqqgrvigddgqeysvwigdnvsi
    thmalihgpayigdgcfigfrstvfnarvgagcvvmmhvliqdveippgkyvpsgmvitt
    qqqadrlpnveesdihfaqhvvgineallsgyqcaeniaciapirnelq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kwcE (E:)
    qsyaapptpwsrdlaepeiaptayvhsfsnligdvrikdyvhiapgtsiradegtpfhig
    srtniqdgvvihglqqgrvigddgqeysvwigdnvsithmalihgpayigdgcfigfrst
    vfnarvgagcvvmmhvliqdveippgkyvpsgmvittqqqadrlpnveesdihfaqhvvg
    ineallsgyqcaeniaciapirnel
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3kwcF (F:)
    mgsshhhhhhssglvprgshmavqsyaapptpwsrdlaepeiaptayvhsfsnligdvri
    kdyvhiapgtsiradegtpfhigsrtniqdgvvihglqqgrvigddgqeysvwigdnvsi
    thmalihgpayigdgcfigfrstvfnarvgagcvvmmhvliqdveippgkyvpsgmvitt
    qqqadrlpnveesdihfaqhvvgineallsgyqcaeniaciapirnelq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kwcF (F:)
    qsyaapptpwsrdlaepeiaptayvhsfsnligdvrikdyvhiapgtsiradegtpfhig
    srtniqdgvvihglqqgrvigddgqeysvwigdnvsithmalihgpayigdgcfigfrst
    vfnarvgagcvvmmhvliqdveippgkyvpsgmvittqqqadrlpnveesdihfaqhvvg
    ineallsgyqcaeniaciapirne