PDB entry 3kvt

View 3kvt on RCSB PDB site
Description: tetramerization domain from akv3.1 (shaw-subfamily) voltage-gated potassium channel
Deposited on 1998-09-25, released 1999-01-13
The last revision prior to the SCOP 1.65 freeze date was dated 1999-06-15, with a file datestamp of 1999-06-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d3kvt__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download) 
    >3kvt_ (-)
mdaenrviinvggirhetykatlkkipatrlsrltegmlnydpvlneyffdrhpgvfaqi
inyyrsgklhyptdvcgplfeeelefwgldsnqvepccwmtytahrdtqetlavl

    Sequence, based on observed residues (ATOM records): (download) 
    >3kvt_ (-)
enrviinvggirhetykatlkkipatrlsrltegmlnydpvlneyffdrhpgvfaqiiny
yrsgklhyptdvcgplfeeelefwgldsnqvepccwmtytahr