PDB entry 3kvt

View 3kvt on RCSB PDB site
Description: tetramerization domain from akv3.1 (shaw-subfamily) voltage-gated potassium channel
Deposited on 1998-09-25, released 1999-01-13
The last revision prior to the SCOP 1.63 freeze date was dated 1999-06-15, with a file datestamp of 1999-06-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.63: d3kvt__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3kvt_ (-)
  enrviinvggirhetykatlkkipatrlsrltegmlnydpvlneyffdrhpgvfaqiiny
  yrsgklhyptdvcgplfeeelefwgldsnqvepccwmtytahr