PDB entry 3kvc

View 3kvc on RCSB PDB site
Description: Crystal structure of bovine RPE65 at 1.9 angstrom resolution
Class: isomerase
Keywords: 7-BLADED BETA-PROPELLER, MONOTOPIC MEMBRANE PROTEIN, SENSORY TRANSDUCTION, VISION, ISOMERASE, NON-HEME IRON PROTEIN, Acetylation, Cell membrane, Cytoplasm, Hydrolase, Iron, Lipoprotein, Membrane, Metal-binding, Palmitate, Phosphoprotein
Deposited on 2009-11-29, released 2010-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoid isomerohydrolase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q28175 (Start-532)
      • variant (340)
    Domains in SCOPe 2.07: d3kvca_
  • Chain 'B':
    Compound: Retinoid isomerohydrolase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q28175 (Start-532)
      • variant (340)
    Domains in SCOPe 2.07: d3kvcb_
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kvcA (A:)
    mssqvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhl
    fdgqallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcafpdpcknifsrff
    syfrgvevtdnalvniypvgedyyactetnfitkvnpetletikqvdlcnyvsvngatah
    phiendgtvynigncfgknfsiaynivkipplqadkedpiskseivvqfpcsdrfkpsyv
    hsfgltpnyivfvetpvkinlfkflsswslwganymdcfesnetmgvwlhiadkkrkkyi
    nnkyrtspfnlfhhintyedheflivdlccwkgfefvynylylanlrenweevkknarka
    pqpevrryvlplnidkadtgknlvtlpnttatailcsdetiwlepevlfsgprqafefpq
    inyqkyggkpytyayglglnhfvpdrlcklnvktketwvwqepdsypsepifvshpdale
    eddgvvlsvvvspgagqkpayllilnakdlsevaraeveinipvtfhglfkks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kvcA (A:)
    sqvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhlfd
    gqallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcaevtdnalvniypvge
    dyyactetnfitkvnpetletikqvdlcnyvsvngatahphiendgtvynigncfgsiay
    nivkipplqadkedpiskseivvqfpcsdrfkpsyvhsfgltpnyivfvetpvkingany
    mdcfesnetmgvwlhiadkkrkkyinnkyrtspfnlfhhintyedheflivdlccwkgfe
    fvynylylanlrenweevkknarkapqpevrryvlplnidkadtgknlvtlpnttatail
    csdetiwlepevlfsgprqafefpqinyqkyggkpytyayglglnhfvpdrlcklnvktk
    etwvwqepdsypsepifvshpdaleeddgvvlsvvvspgagqkpayllilnakdlsevar
    aeveinipvtfhglfkks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kvcB (B:)
    mssqvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhl
    fdgqallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcafpdpcknifsrff
    syfrgvevtdnalvniypvgedyyactetnfitkvnpetletikqvdlcnyvsvngatah
    phiendgtvynigncfgknfsiaynivkipplqadkedpiskseivvqfpcsdrfkpsyv
    hsfgltpnyivfvetpvkinlfkflsswslwganymdcfesnetmgvwlhiadkkrkkyi
    nnkyrtspfnlfhhintyedheflivdlccwkgfefvynylylanlrenweevkknarka
    pqpevrryvlplnidkadtgknlvtlpnttatailcsdetiwlepevlfsgprqafefpq
    inyqkyggkpytyayglglnhfvpdrlcklnvktketwvwqepdsypsepifvshpdale
    eddgvvlsvvvspgagqkpayllilnakdlsevaraeveinipvtfhglfkks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kvcB (B:)
    sqvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhlfd
    gqallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcaevtdnalvniypvge
    dyyactetnfitkvnpetletikqvdlcnyvsvngatahphiendgtvynigncfgsiay
    nivkipplqadkedpiskseivvqfpcsdrfkpsyvhsfgltpnyivfvetpvkinanym
    dcfesnetmgvwlhiadkkrkkyinnkyrtspfnlfhhintyedheflivdlccwkgfef
    vynylylanlrenweevkknarkapqpevrryvlplnidkadtgknlvtlpnttatailc
    sdetiwlepevlfsgprqafefpqinyqkyggkpytyayglglnhfvpdrlcklnvktke
    twvwqepdsypsepifvshpdaleeddgvvlsvvvspgagqkpayllilnakdlsevara
    eveinipvtfhglfkks