PDB entry 3kup

View 3kup on RCSB PDB site
Description: Crystal Structure of the CBX3 Chromo Shadow Domain
Class: transcription
Keywords: chromo shadow domain, Structural Genomics Consortium, SGC, Acetylation, Chromatin regulator, Nucleus, Phosphoprotein, Repressor, Transcription, Transcription regulation
Deposited on 2009-11-27, released 2009-12-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-12-08, with a file datestamp of 2009-12-04.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.222
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromobox protein homolog 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kupa_
  • Chain 'B':
    Compound: Chromobox protein homolog 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kupb_
  • Chain 'C':
    Compound: Chromobox protein homolog 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kupc_
  • Chain 'D':
    Compound: Chromobox protein homolog 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kupd_
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kupA (A:)
    gaadkprgfargldperiigatdssgelmflmkwkdsdeadlvlakeanmkcpqiviafy
    eerlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kupA (A:)
    prgfargldperiigatdssgelmflmkwkdsdeadlvlakeanmkcpqiviafyeerl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kupB (B:)
    gaadkprgfargldperiigatdssgelmflmkwkdsdeadlvlakeanmkcpqiviafy
    eerlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kupB (B:)
    dkprgfargldperiigatdssgelmflmkwkdsdeadlvlakeanmkcpqiviafyeer
    lt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3kupC (C:)
    gaadkprgfargldperiigatdssgelmflmkwkdsdeadlvlakeanmkcpqiviafy
    eerlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kupC (C:)
    dkprgfargldperiigatdgelmflmkwkdsdeadlvlakeanmkcpqiviafyeerl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3kupD (D:)
    gaadkprgfargldperiigatdssgelmflmkwkdsdeadlvlakeanmkcpqiviafy
    eerlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kupD (D:)
    prgfargldperiigatdssgelmflmkwkdsdeadlvlakeanmkcpqiviafyeerlt