PDB entry 3kuo

View 3kuo on RCSB PDB site
Description: X-ray structure of the metcyano form of dehaloperoxidase from amphitrite ornata: evidence for photoreductive lysis of iron-cyanide bond
Class: oxidoreductase
Keywords: Crystal structure of metcyano form of dehaloperoxydase, heme, oxygen transport, peroxidase, transport, transport protein, OXIDOREDUCTASE
Deposited on 2009-11-27, released 2010-06-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: 0.178
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Gene: dhpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NAV8 (0-136)
      • conflict (72)
    Domains in SCOPe 2.08: d3kuoa_
  • Chain 'B':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Gene: dhpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NAV8 (0-136)
      • conflict (72)
    Domains in SCOPe 2.08: d3kuob_
  • Heterogens: HEM, CYN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3kuoA (A:)
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdsvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3kuoB (B:)
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdsvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk