PDB entry 3kul

View 3kul on RCSB PDB site
Description: Kinase domain of human ephrin type-A receptor 8 (EPHA8)
Class: transferase
Keywords: ATP-binding, kinase, nucleotide-binding, receptor, transferase, phosphorylation, transmembrane, tyrosine-protein kinase, Structural Genomics Consortium, SGC, Glycoprotein, Membrane, Phosphoprotein
Deposited on 2009-11-27, released 2009-12-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.19
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ephrin type-a receptor 8
    Species: Homo sapiens [TaxId:9606]
    Gene: EEK, EPHA8, HEK3, KIAA1459
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3kula_
  • Chain 'B':
    Compound: ephrin type-a receptor 8
    Species: Homo sapiens [TaxId:9606]
    Gene: EEK, EPHA8, HEK3, KIAA1459
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3kulb_
  • Heterogens: SO4, BME, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kulA (A:)
    mhhhhhhssgrenlyfqgklpepqfyaephtyeepgragrsftreieasrihiekiigsg
    dsgevcygrlrvpgqrdvpvaikalkagyterqrrdflseasimgqfdhpniirlegvvt
    rgrlamivteymengsldtflrthdgqftimqlvgmlrgvgagmrylsdlgyvhrdlaar
    nvlvdsnlvckvsdfglsrvleddpdaaytttggkipirwtapeaiafrtfssasdvwsf
    gvvmwevlaygerpywnmtnrdvissveegyrlpapmgcphalhqlmldcwhkdraqrpr
    fsqivsvldalirspeslratatvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kulA (A:)
    treieasrihiekiigsgdsgevcygrlrvpgqrdvpvaikalkagyterqrrdflseas
    imgqfdhpniirlegvvtrgrlamivteymengsldtflrthdgqftimqlvgmlrgvga
    gmrylsdlgyvhrdlaarnvlvdsnlvckvsdfglsrvleaaytttipirwtapeaiafr
    tfssasdvwsfgvvmwevlaygerpywnmtnrdvissveegyrlpapmgcphalhqlmld
    cwhkdraqrprfsqivsvldalirspe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kulB (B:)
    mhhhhhhssgrenlyfqgklpepqfyaephtyeepgragrsftreieasrihiekiigsg
    dsgevcygrlrvpgqrdvpvaikalkagyterqrrdflseasimgqfdhpniirlegvvt
    rgrlamivteymengsldtflrthdgqftimqlvgmlrgvgagmrylsdlgyvhrdlaar
    nvlvdsnlvckvsdfglsrvleddpdaaytttggkipirwtapeaiafrtfssasdvwsf
    gvvmwevlaygerpywnmtnrdvissveegyrlpapmgcphalhqlmldcwhkdraqrpr
    fsqivsvldalirspeslratatvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kulB (B:)
    treieasrihiekiigsgdsgevcygrlrvpgqrdvpvaikalkagyterqrrdflseas
    imgqfdhpniirlegvvtrgrlamivteymengsldtflrthdgqftimqlvgmlrgvga
    gmrylsdlgyvhrdlaarnvlvdsnlvckvsdfglsrvleddpdaayttggkipirwtap
    eaiafrtfssasdvwsfgvvmwevlaygerpywnmtnrdvissveegyrlpapmgcphal
    hqlmldcwhkdraqrprfsqivsvldalirsp