PDB entry 3kuh

View 3kuh on RCSB PDB site
Description: Crystal structure of E. coli HPPK(H115A) in complex with AMPCPP and HP
Class: transferase
Keywords: alpha beta, ATP-binding, Folate biosynthesis, Kinase, Nucleotide-binding, TRANSFERASE
Deposited on 2009-11-27, released 2010-11-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  Species: Escherichia coli [TaxId:83333]
  Gene: b0142, foIK, folK, JW0138
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26281 (0-157)
    • engineered (114)
  Domains in SCOPe 2.08: d3kuha_
• Heterogens: APC, PH2, MG, CL, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3kuhA (A:)
  tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
  etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvpaydmkn
  rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw