PDB entry 3kua

View 3kua on RCSB PDB site
Description: CcdBVfi:GyrA14Vfi
Class: toxin/isomerase
Keywords: ALPHA+BETA, SH3 domain, Topoisomerase, TOXIN-ISOMERASE complex
Deposited on 2009-11-27, released 2010-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.196
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase (Type II topoisomerase), subunit A
    Species: Vibrio fischeri [TaxId:312309]
    Gene: gyrase
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5E5J7 (21-152)
      • expression tag (10-20)
    Domains in SCOPe 2.08: d3kuaa1, d3kuaa2
  • Chain 'B':
    Compound: DNA gyrase (Type II topoisomerase), subunit A
    Species: Vibrio fischeri [TaxId:312309]
    Gene: gyrase
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5E5J7 (21-End)
      • expression tag (20)
    Domains in SCOPe 2.08: d3kuab1, d3kuab2
  • Chain 'C':
    Compound: ccdb
    Species: Vibrio fischeri [TaxId:668]
    Gene: CCDB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3kuac_
  • Chain 'D':
    Compound: ccdb
    Species: Vibrio fischeri [TaxId:668]
    Gene: CCDB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3kuad_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kuaA (A:)
    mgsshhhhhhssglvprgshmtrrtifelrkardrahileglalalanideiieliknap
    tpaeakeglisrgwdlgnvasmleragtdaarpdwlepefgiregkyflteqqaqailel
    rlhrltglehekildeykalldeiaelmhilas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kuaA (A:)
    ssglvprgshmtrrtifelrkardrahileglalalanideiieliknaptpaeakegli
    srgwdlgnvasmleragtdaarpdwlepefgiregkyflteqqaqailelrlhrltgleh
    ekildeykalldeiaelmhilas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kuaB (B:)
    mgsshhhhhhssglvprgshmtrrtifelrkardrahileglalalanideiieliknap
    tpaeakeglisrgwdlgnvasmleragtdaarpdwlepefgiregkyflteqqaqailel
    rlhrltglehekildeykalldeiaelmhilas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kuaB (B:)
    mtrrtifelrkardrahileglalalanideiieliknaptpaeakeglisrgwdlgnva
    smleragtdaarpdwlepefgiregkyflteqqaqailelrlhrltglehekildeykal
    ldeiaelmhil
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3kuaC (C:)
    msqftlyknkdkssaktypyfvdvqsdlldnlntrlvipltpielldkkapshlcptihi
    degdfimltqqmtsvpvkilsepvnelstfrneiiaaidflitgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kuaC (C:)
    sqftlyknkdkssaktypyfvdvqsdlldnlntrlvipltpielldkkapshlcptihid
    egdfimltqqmtsvpvkilsepvnelstfrneiiaaidflitgi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3kuaD (D:)
    msqftlyknkdkssaktypyfvdvqsdlldnlntrlvipltpielldkkapshlcptihi
    degdfimltqqmtsvpvkilsepvnelstfrneiiaaidflitgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kuaD (D:)
    sqftlyknkdkssaktypyfvdvqsdlldnlntrlvipltpiellkapshlcptihideg
    dfimltqqmtsvpvkilsepvnelstfrneiiaaidflitg