PDB entry 3ku3

View 3ku3 on RCSB PDB site
Description: Crystal structure of a H2N2 influenza virus hemagglutinin, avian like
Class: viral protein
Keywords: viral envelope protein, hemagglutinin, viral fusion protein, Envelope protein, VIRAL PROTEIN
Deposited on 2009-11-26, released 2010-01-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.201
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:387161]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7S226 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.03: d3ku3a_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:387161]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ku3A (A:)
    pgdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsia
    gwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilp
    kdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvh
    hpndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvngqggrmefswtlldmwdti
    nfestgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhplti
    gecpkyvkseklvlatglrnvpqiesr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ku3A (A:)
    pgdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsia
    gwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilp
    kdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvh
    hpndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvngqggrmefswtlldmwdti
    nfestgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhplti
    gecpkyvkseklvlatglrnvpqi
    

  • Chain 'B':
    No sequence available.