PDB entry 3ktx

View 3ktx on RCSB PDB site
Description: Crystal structure of Leishmania mexicana pyruvate kinase (LmPYK)in complex with 1,3,6,8-pyrenetetrasulfonic acid
Class: transferase
Keywords: TRANSFERASE, Allosteric enzyme, ATP-binding, Glycolysis, Kinase, Magnesium, Metal-binding, Nucleotide-binding, Pyruvate
Deposited on 2009-11-26, released 2010-02-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.188
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate kinase
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27686 (Start-498)
      • conflict (382)
      • conflict (389)
      • conflict (404-405)
    Domains in SCOPe 2.06: d3ktxa1, d3ktxa2, d3ktxa3
  • Chain 'B':
    Compound: pyruvate kinase
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27686 (Start-498)
      • conflict (382)
      • conflict (389)
      • conflict (404-405)
    Domains in SCOPe 2.06: d3ktxb1, d3ktxb2, d3ktxb3
  • Heterogens: GOL, PTK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ktxA (A:)
    msqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgshey
    hqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkg
    tkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnl
    pgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiicki
    enhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqml
    esmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalne
    yvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpiv
    cvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvi
    hadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ktxA (A:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    ayanqtrillve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ktxB (B:)
    msqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgshey
    hqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkg
    tkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnl
    pgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiicki
    enhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqml
    esmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalne
    yvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpiv
    cvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvi
    hadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ktxB (B:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    ayanqtrillve