PDB entry 3ktn

View 3ktn on RCSB PDB site
Description: Crystal Structure of a putative 2-Keto-3-deoxygluconate Kinase from Enterococcus faecalis
Class: transferase
Keywords: KINASE, PFKB FAMILY, RIBOKIANSE, 2-Keto-3-deoxygluconate Kinase, PSI-II, NYSGXRC, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, TRANSFERASE
Deposited on 2009-11-25, released 2009-12-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbohydrate kinase, PfkB family
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: 1199733, EF_0840
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q837J7 (3-337)
      • expression tag (1-2)
      • expression tag (338-340)
    Domains in SCOPe 2.08: d3ktna1, d3ktna2, d3ktna3
  • Heterogens: SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ktnA (A:)
    mslkiaafgevmlrftppeylmleqteqlrmnfvgtgvnllanlahfqletalitklpan
    rlgeagkaalrklgisdqwvgekgdhigsffaemgygirptqvtyqnrhqsafgiseakd
    ydfeaflaevdmvhicgislsltektrdaalilaqkahayqkkvcfdfnyrpslntansa
    lfmrqqyerilpycdivfgsrrdlvellgfipredlegeaqeteliqrfmsqynlewfag
    ttrshsqnqnylsgylytqneyqqsekrpllnldrigagdayaagilygysqnwslekav
    tfatvngvlahtiqgdiplttvkqvnhvlehpnidlireghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ktnA (A:)
    slkiaafgevmlrftppeylmleqteqlrmnfvgtgvnllanlahfqletalitklpanr
    lgeagkaalrklgisdqwvgekgdhigsffaemgygirptqvtyqnrhqsafgiseakdy
    dfeaflaevdmvhicgislsltektrdaalilaqkahayqkkvcfdfnyrpslntansal
    fmrqqyerilpycdivfgsrrdlvellgfipredlegeaqeteliqrfmsqynlewfagt
    trshsqnqnylsgylytqneyqqsekrpllnldrigagdayaagilygysqnwslekavt
    fatvngvlahtiqgdiplttvkqvnhvlehpnidliregh