PDB entry 3ktl

View 3ktl on RCSB PDB site
Description: Crystal Structure of an I71A human GSTA1-1 mutant in complex with S-hexylglutathione
Class: transferase
Keywords: Thioredoxin, S-hexylglutathione, Glutathione S-transferase, Transferase
Deposited on 2009-11-25, released 2009-12-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.211
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263 (0-220)
      • engineered (69)
    Domains in SCOPe 2.06: d3ktla1, d3ktla2
  • Chain 'B':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263 (Start-220)
      • engineered (69)
    Domains in SCOPe 2.06: d3ktlb1, d3ktlb2
  • Heterogens: GTX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ktlA (A:)
    aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtraalnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleearkifrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ktlB (B:)
    aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtraalnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ktlB (B:)
    kpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveidgm
    klvqtraalnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdaklal
    ikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpllka
    lktrisnlptvkkflqpgsprkppmdeksleearkifrf