PDB entry 3ktj

View 3ktj on RCSB PDB site
Description: Structure of ClpP in complex with ADEP2 in monoclinic crystal form
Class: hydrolase/antibiotic
Keywords: hydrolase, Protease, Serine protease, Stress response, A54556A, enopeptin, depsipeptide, antibiotics, HYDROLASE-ANTIBIOTIC complex
Deposited on 2009-11-25, released 2010-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-10, with a file datestamp of 2010-11-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.226
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Bacillus subtilis [TaxId:1423]
    Gene: clpP, yvdN, BSU34540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ktja_
  • Chain 'B':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Bacillus subtilis [TaxId:1423]
    Gene: clpP, yvdN, BSU34540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ktjb_
  • Chain 'C':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Bacillus subtilis [TaxId:1423]
    Gene: clpP, yvdN, BSU34540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ktjc_
  • Chain 'D':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Bacillus subtilis [TaxId:1423]
    Gene: clpP, yvdN, BSU34540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ktjd_
  • Chain 'E':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Bacillus subtilis [TaxId:1423]
    Gene: clpP, yvdN, BSU34540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ktje_
  • Chain 'F':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Bacillus subtilis [TaxId:1423]
    Gene: clpP, yvdN, BSU34540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ktjf_
  • Chain 'G':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Bacillus subtilis [TaxId:1423]
    Gene: clpP, yvdN, BSU34540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ktjg_
  • Chain 'H':
    Compound: Acyldepsipeptide 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • NOR NOR01131 (0-6)
      • see remark 999 (0-1)
      • see remark 999 (4)
  • Chain 'I':
    Compound: Acyldepsipeptide 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • NOR NOR01131 (0-6)
      • see remark 999 (0-1)
      • see remark 999 (4)
  • Chain 'J':
    Compound: Acyldepsipeptide 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • NOR NOR01131 (0-6)
      • see remark 999 (0-1)
      • see remark 999 (4)
  • Chain 'K':
    Compound: Acyldepsipeptide 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • NOR NOR01131 (0-6)
      • see remark 999 (0-1)
      • see remark 999 (4)
  • Chain 'L':
    Compound: Acyldepsipeptide 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • NOR NOR01131 (0-6)
      • see remark 999 (0-1)
      • see remark 999 (4)
  • Chain 'M':
    Compound: Acyldepsipeptide 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • NOR NOR01131 (0-6)
      • see remark 999 (0-1)
      • see remark 999 (4)
  • Chain 'N':
    Compound: Acyldepsipeptide 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • NOR NOR01131 (0-6)
      • see remark 999 (0-1)
      • see remark 999 (4)
  • Heterogens: NHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ktjA (A:)
    nliptvieqtnrgeraydiysrllkdriimlgsaiddnvansivsqllflaaedpekeis
    lyinspggsitagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevm
    ihqplggaqgqateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeeal
    eyglidkilthtedkkhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ktjA (A:)
    diysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsitagmaiy
    dtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqgqateiei
    aakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilth
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ktjB (B:)
    nliptvieqtnrgeraydiysrllkdriimlgsaiddnvansivsqllflaaedpekeis
    lyinspggsitagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevm
    ihqplggaqgqateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeeal
    eyglidkilthtedkkhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ktjB (B:)
    diysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsitagmaiy
    dtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqgqateiei
    aakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilth
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ktjC (C:)
    nliptvieqtnrgeraydiysrllkdriimlgsaiddnvansivsqllflaaedpekeis
    lyinspggsitagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevm
    ihqplggaqgqateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeeal
    eyglidkilthtedkkhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ktjC (C:)
    diysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsitagmaiy
    dtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqgqateiei
    aakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilth
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ktjD (D:)
    nliptvieqtnrgeraydiysrllkdriimlgsaiddnvansivsqllflaaedpekeis
    lyinspggsitagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevm
    ihqplggaqgqateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeeal
    eyglidkilthtedkkhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ktjD (D:)
    diysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsitagmaiy
    dtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqgqateiei
    aakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilth
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ktjE (E:)
    nliptvieqtnrgeraydiysrllkdriimlgsaiddnvansivsqllflaaedpekeis
    lyinspggsitagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevm
    ihqplggaqgqateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeeal
    eyglidkilthtedkkhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ktjE (E:)
    diysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsitagmaiy
    dtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqgqateiei
    aakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilth
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ktjF (F:)
    nliptvieqtnrgeraydiysrllkdriimlgsaiddnvansivsqllflaaedpekeis
    lyinspggsitagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevm
    ihqplggaqgqateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeeal
    eyglidkilthtedkkhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ktjF (F:)
    diysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsitagmaiy
    dtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqgqateiei
    aakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilth
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ktjG (G:)
    nliptvieqtnrgeraydiysrllkdriimlgsaiddnvansivsqllflaaedpekeis
    lyinspggsitagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevm
    ihqplggaqgqateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeeal
    eyglidkilthtedkkhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ktjG (G:)
    diysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsitagmaiy
    dtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqgqateiei
    aakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilth
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.