PDB entry 3ksk

View 3ksk on RCSB PDB site
Description: Crystal Structure of single chain PvuII
Class: hydrolase
Keywords: single chain restriction endonuclease, DNA-binding protein, Endonuclease, Hydrolase, Magnesium, Metal-binding, Nuclease, Restriction system
Deposited on 2009-11-23, released 2010-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type-2 restriction enzyme PvuII
    Species: Proteus hauseri [TaxId:183417]
    Gene: pvuII, pvuIIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23657 (160-315)
      • linker (156-159)
      • expression tag (316-317)
    Domains in SCOPe 2.07: d3kska1, d3kska2, d3kska3
  • Chain 'B':
    Compound: Type-2 restriction enzyme PvuII
    Species: Proteus hauseri [TaxId:183417]
    Gene: pvuII, pvuIIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23657 (160-315)
      • linker (156-159)
      • expression tag (316)
    Domains in SCOPe 2.07: d3kskb1, d3kskb2, d3kskb3
  • Heterogens: SO4, MPD, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kskA (A:)
    shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
    nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
    fyydkwerkwysdghkdinnpkipvkyvmehgtkiygsggshpdlnkllelwphiqeyqd
    lalkhgindifqdnggkllqvllitgltvlpgregndavdnagqeyelksinidltkgfs
    thhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdlefyydkwerkwysdghkdinn
    pkipvkyvmehgtkiygshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kskA (A:)
    shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgndavdnag
    qeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdlefyy
    dkwerkwysdghkdinnpkipvkyvmehgtkiygsggshpdlnkllelwphiqeyqdlal
    khgindifqdnggkllqvllitgltvlpggndavdnagqeyelksinidltkgfsthhhm
    npviiakyrqvpwifaiyrgiaieaiyrlepkdlefyydkwerkwysdghkdinnpkipv
    kyvmehgtkiygs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kskB (B:)
    shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
    nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
    fyydkwerkwysdghkdinnpkipvkyvmehgtkiygsggshpdlnkllelwphiqeyqd
    lalkhgindifqdnggkllqvllitgltvlpgregndavdnagqeyelksinidltkgfs
    thhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdlefyydkwerkwysdghkdinn
    pkipvkyvmehgtkiygshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kskB (B:)
    shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgndavdnag
    qeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdlefyy
    dkwerkwysdghkdinnpkipvkyvmehgtkiygsggshpdlnkllelwphiqeyqdlal
    khgindifqdnggkllqvllitgltvlpgndavdnagqeyelksinidltkgfsthhhmn
    pviiakyrqvpwifaiyrgiaieaiyrlepkdlefyydkwerkwysdghkdinnpkipvk
    yvmehgtkiyg