PDB entry 3krj

View 3krj on RCSB PDB site
Description: cFMS tyrosine kinase in complex with 4-Cyano-1H-imidazole-2-carboxylic acid (2-cyclohex-1-enyl-4-piperidin-4-yl-phenyl)-amide
Class: transferase/transferase inhibitor
Keywords: Kinase, inhibitor, chimera, ATP-binding, Disulfide bond, Glycoprotein, Immunoglobulin domain, Membrane, Nucleotide-binding, Phosphoprotein, Proto-oncogene, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2009-11-18, released 2010-12-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.213
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage colony-stimulating factor 1 receptor, Basic fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CSF1R, FMS, FGFR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3krja_
  • Heterogens: ACT, KRJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3krjA (A:)
    gvdykykqkpkyqvrwkiiesyegnsytfidptqlpynekwefprnnlqfgktlgagafg
    kvveatafglgkedavlkvavkmlkstahadekealmselkimshlgqhenivnllgact
    hggpvlviteyccygdllnflrrkrppgleysynpshnpeeqlssrdllhfssqvaqgma
    flaskncihrdvaarnvlltnghvakigdfglardimndsnyivkgnarlpvkwmapesi
    fdcvytvqsdvwsygillweifslglnpypgilvnskfyklvkdgyqmaqpafapkniys
    imqacwalepthrptfqqicsflqeqaqedrrerd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krjA (A:)
    pkyqvrwkiiesyegnsytfidptqlpynekwefprnnlqfgktlgagafgkvveatafg
    lgkedavlkvavkmlkstahadekealmselkimshlgqhenivnllgacthggpvlvit
    eyccygdllnflrrkrppgqlssrdllhfssqvaqgmaflaskncihrdvaarnvlltng
    hvakigdfglardimndsnyivkgarlpvkwmapesifdcvytvqsdvwsygillweifs
    lglnpypgilvnskfyklvkdgyqmaqpafapkniysimqacwalepthrptfqqicsfl
    qeqa