PDB entry 3kr3

View 3kr3 on RCSB PDB site
Description: Crystal structure of IGF-II antibody complex
Class: immune system
Keywords: Antibody-target complex, Carbohydrate metabolism, Glucose metabolism, Glycoprotein, Growth factor, Hormone, Mitogen, Osteogenesis, Secreted, IMMUNE SYSTEM
Deposited on 2009-11-17, released 2010-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-07-07, with a file datestamp of 2010-07-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.202
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: insulin-like growth factor II
    Species: Homo sapiens [TaxId:9606]
    Gene: IGF-II, IGF2, PP1446
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kr3d_
  • Chain 'H':
    Compound: antibody-Fab (heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KR3 (0-End)
  • Chain 'L':
    Compound: antibody-Fab (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KR3 (0-End)
    Domains in SCOPe 2.07: d3kr3l1, d3kr3l2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3kr3D (D:)
    ayrpsetlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletyc
    atpakse
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kr3D (D:)
    setlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletycatpa
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3kr3L (L:)
    qdiqmtqspsslsasvgdrvtitcrasqsisnylnwyqqkpgkapklliytastlqsgvp
    srfsgsasgtdftltinslqpedfatyscqqsynspwtfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvtqedskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kr3L (L:)
    qdiqmtqspsslsasvgdrvtitcrasqsisnylnwyqqkpgkapklliytastlqsgvp
    srfsgsasgtdftltinslqpedfatyscqqsynspwtfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvtqedskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge