PDB entry 3kqu

View 3kqu on RCSB PDB site
Description: Three Conformational Snapshots of the Hepatitis C Virus NS3 Helicase Reveal a Ratchet Translocation Mechanism
Class: hydrolase/DNA
Keywords: helicase-substrate ground-state complex, HCV, NS3 protein, helicase, DNA-binding, HYDROLASE-DNA complex
Deposited on 2009-11-17, released 2010-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine protease/NTPase/helicase NS3
    Species: Hepatitis C virus [TaxId:333284]
    Gene: NS3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WMX2 (0-435)
      • expression tag (436)
    Domains in SCOPe 2.07: d3kqua1, d3kqua2, d3kqua3
  • Chain 'B':
    Compound: Serine protease/NTPase/helicase NS3
    Species: Hepatitis C virus [TaxId:333284]
    Gene: NS3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WMX2 (0-435)
      • expression tag (436)
    Domains in SCOPe 2.07: d3kqub1, d3kqub2, d3kqub3
  • Chain 'C':
    Compound: Serine protease/NTPase/helicase NS3
    Species: Hepatitis C virus [TaxId:333284]
    Gene: NS3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WMX2 (0-435)
      • expression tag (436)
    Domains in SCOPe 2.07: d3kquc1, d3kquc2, d3kquc3
  • Chain 'D':
    Compound: Serine protease/NTPase/helicase NS3
    Species: Hepatitis C virus [TaxId:333284]
    Gene: NS3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WMX2 (0-435)
      • expression tag (436)
    Domains in SCOPe 2.07: d3kqud1, d3kqud2, d3kqud3
  • Chain 'E':
    Compound: Serine protease/NTPase/helicase NS3
    Species: Hepatitis C virus [TaxId:333284]
    Gene: NS3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WMX2 (0-435)
      • expression tag (436)
    Domains in SCOPe 2.07: d3kque1, d3kque2, d3kque3
  • Chain 'F':
    Compound: Serine protease/NTPase/helicase NS3
    Species: Hepatitis C virus [TaxId:333284]
    Gene: NS3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WMX2 (0-435)
      • expression tag (436)
    Domains in SCOPe 2.07: d3kquf1, d3kquf2, d3kquf3
  • Chain 'M':
    Compound: 5'-d(*t*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*t)-3'
  • Chain 'N':
    Compound: 5'-d(*t*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*t)-3'
  • Heterogens: BEF, ADP, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kquA (A:)
    sppavpqtfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahgi
    dpnirtgvrtittgapitystygkfladggcsggaydiiicdechstdsttilgigtvld
    qaetagarlvvlatatppgsvtvphpnieevalsstgeipfygkaipietikggrhlifc
    hskkkcdelaaklsglglnavayyrgldvsviptsgdvivvatdalmtgftgdfdsvidc
    ntcvtqtvdfsldptftietttvpqdavsrsqrrgrtgrgrmgiyrfvtpgerpsgmfds
    svlcecydagcawyeltpaetsvrlraylntpglpvcqdhlefwesvftglthidahfls
    qtkqagdnfpylvayqatvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqne
    vttthpitkyimacmsa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kquB (B:)
    sppavpqtfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahgi
    dpnirtgvrtittgapitystygkfladggcsggaydiiicdechstdsttilgigtvld
    qaetagarlvvlatatppgsvtvphpnieevalsstgeipfygkaipietikggrhlifc
    hskkkcdelaaklsglglnavayyrgldvsviptsgdvivvatdalmtgftgdfdsvidc
    ntcvtqtvdfsldptftietttvpqdavsrsqrrgrtgrgrmgiyrfvtpgerpsgmfds
    svlcecydagcawyeltpaetsvrlraylntpglpvcqdhlefwesvftglthidahfls
    qtkqagdnfpylvayqatvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqne
    vttthpitkyimacmsa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kquC (C:)
    sppavpqtfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahgi
    dpnirtgvrtittgapitystygkfladggcsggaydiiicdechstdsttilgigtvld
    qaetagarlvvlatatppgsvtvphpnieevalsstgeipfygkaipietikggrhlifc
    hskkkcdelaaklsglglnavayyrgldvsviptsgdvivvatdalmtgftgdfdsvidc
    ntcvtqtvdfsldptftietttvpqdavsrsqrrgrtgrgrmgiyrfvtpgerpsgmfds
    svlcecydagcawyeltpaetsvrlraylntpglpvcqdhlefwesvftglthidahfls
    qtkqagdnfpylvayqatvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqne
    vttthpitkyimacmsa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kquD (D:)
    sppavpqtfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahgi
    dpnirtgvrtittgapitystygkfladggcsggaydiiicdechstdsttilgigtvld
    qaetagarlvvlatatppgsvtvphpnieevalsstgeipfygkaipietikggrhlifc
    hskkkcdelaaklsglglnavayyrgldvsviptsgdvivvatdalmtgftgdfdsvidc
    ntcvtqtvdfsldptftietttvpqdavsrsqrrgrtgrgrmgiyrfvtpgerpsgmfds
    svlcecydagcawyeltpaetsvrlraylntpglpvcqdhlefwesvftglthidahfls
    qtkqagdnfpylvayqatvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqne
    vttthpitkyimacmsa
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kquE (E:)
    sppavpqtfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahgi
    dpnirtgvrtittgapitystygkfladggcsggaydiiicdechstdsttilgigtvld
    qaetagarlvvlatatppgsvtvphpnieevalsstgeipfygkaipietikggrhlifc
    hskkkcdelaaklsglglnavayyrgldvsviptsgdvivvatdalmtgftgdfdsvidc
    ntcvtqtvdfsldptftietttvpqdavsrsqrrgrtgrgrmgiyrfvtpgerpsgmfds
    svlcecydagcawyeltpaetsvrlraylntpglpvcqdhlefwesvftglthidahfls
    qtkqagdnfpylvayqatvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqne
    vttthpitkyimacmsa
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kquF (F:)
    sppavpqtfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahgi
    dpnirtgvrtittgapitystygkfladggcsggaydiiicdechstdsttilgigtvld
    qaetagarlvvlatatppgsvtvphpnieevalsstgeipfygkaipietikggrhlifc
    hskkkcdelaaklsglglnavayyrgldvsviptsgdvivvatdalmtgftgdfdsvidc
    ntcvtqtvdfsldptftietttvpqdavsrsqrrgrtgrgrmgiyrfvtpgerpsgmfds
    svlcecydagcawyeltpaetsvrlraylntpglpvcqdhlefwesvftglthidahfls
    qtkqagdnfpylvayqatvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqne
    vttthpitkyimacmsa
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.