PDB entry 3kqr

View 3kqr on RCSB PDB site
Description: The structure of serum amyloid p component bound to phosphoethanolamine
Class: glycoprotein
Keywords: Glycoprotein, Amyloid, Disulfide bond, Lectin, Metal-binding, Secreted
Deposited on 2009-11-17, released 2010-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-23, with a file datestamp of 2011-03-18.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.142
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kqra_
  • Chain 'B':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kqrb_
  • Chain 'C':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kqrc_
  • Chain 'D':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kqrd_
  • Chain 'E':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kqre_
  • Heterogens: OPE, CA, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kqrA (A:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kqrB (B:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kqrC (C:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kqrD (D:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kqrE (E:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv