PDB entry 3kqi

View 3kqi on RCSB PDB site
Description: crystal structure of PHF2 PHD domain complexed with H3K4Me3 peptide
Class: nuclear protein
Keywords: PHD finger, Metal-binding, Zinc-finger, Histone-binding, NUCLEAR PROTEIN
Deposited on 2009-11-17, released 2010-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.191
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: PHD finger protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: KIAA0662, PHF2
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75151 (5-End)
    • expression tag (3-4)
  Domains in SCOPe 2.07: d3kqia1, d3kqia2
• Chain 'B':
  Compound: H3K4Me3 peptide
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68431 (0-End)
• Heterogens: ZN, GOL, CL, MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3kqiA (A:)
  gplgsmatvpvycvcrlpydvtrfmiecdackdwfhgscvgveeeeapdidiyhcpncek
  thgkstlkkkrtwhk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3kqiA (A:)
  gsmatvpvycvcrlpydvtrfmiecdackdwfhgscvgveeeeapdidiyhcpncekthg
  kstlkkkrtwh
  

  
  
• Chain 'B':
  No sequence available.