PDB entry 3kq7

View 3kq7 on RCSB PDB site
Description: Structure of human p38alpha with N-[4-methyl-3-(6-{[2-(1-methylpyrrolidin-2-yl)ethyl]amino}pyridine-3-amido)phenyl]-2-(morpholin-4-yl)pyridine-4-carboxamide
Class: transferase
Keywords: p38alpha kinase, alternative splicing, ATP binding, cytoplasm, kinase, nucleotide-binding, nucleus, phosphoprotein, polymorphism, serine/threonine-protein kinase, transferase
Deposited on 2009-11-17, released 2009-12-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-12-01, with a file datestamp of 2009-11-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase p38 alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kq7a_
  • Heterogens: KQ7, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kq7A (A:)
    mgsshhhhhhssglvprgshmsqerptfyrqelnktiwevperyqnlspvgsgaygsvca
    afdtktglrvavkklsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefn
    dvylvthlmgadlnnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavne
    dcelkildfglarhtddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgr
    tlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganpl
    avdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksl
    tydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kq7A (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyva
    trwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpga
    ellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqala
    hayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp