PDB entry 3kpz

View 3kpz on RCSB PDB site
Description: Crystal structure of a novel vitamin D3 analogue, ZK203278 showing dissociated profile
Class: Transcription/Hormone
Keywords: nuclear receptor, agonist, DNA-binding, Transcription regulation, Transcription-Hormone complex
Deposited on 2009-11-17, released 2011-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: Vdr, Nr1i1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kpza_
  • Heterogens: ZNE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kpzA (A:)
    dslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlp
    hladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtc
    gnqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqd
    aalieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqp
    ecsmkltplvlevfgneis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kpzA (A:)
    lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
    adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
    qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
    lieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpec
    smkltplvlevfg