PDB entry 3kpc

View 3kpc on RCSB PDB site
Description: Crystal Structure of the CBS domain pair of protein MJ0100 in complex with 5 -methylthioadenosine and S-adenosyl-L-methionine
Class: unknown function
Keywords: CBS domain; s-adenosylmethionine; conformational change, CBS domain, UNKNOWN FUNCTION
Deposited on 2009-11-16, released 2010-01-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.217
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein MJ0100
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0100
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3kpca_
  • Heterogens: SAM, MTA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kpcA (A:)
    pitlvkdilskppitahsnisimeaakilikhninhlpivdehgklvgiitswdiakala
    qnkktieeimtrnvitahedepvdhvaikmskynisgvpvvddyrrvvgivtsedisrlf
    ggkk