PDB entry 3kpa

View 3kpa on RCSB PDB site
Description: Ubiquitin fold modifier conjugating enzyme from Leishmania major (probable)
Class: ligase
Keywords: UBL CONJUGATION PATHWAY, LIGASE, Structural Genomics, PSI, Structural Genomics of Pathogenic Protozoa Consortium, SGPP
Deposited on 2009-11-16, released 2009-12-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable Ubiquitin fold modifier conjugating enzyme
    Species: Leishmania major [TaxId:5664]
    Gene: LmjF15.1250
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4QF57 (Start-167)
      • engineered (159)
    Domains in SCOPe 2.05: d3kpaa_
  • Chain 'B':
    Compound: probable Ubiquitin fold modifier conjugating enzyme
    Species: Leishmania major [TaxId:5664]
    Gene: LmjF15.1250
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4QF57 (Start-167)
      • engineered (159)
    Domains in SCOPe 2.05: d3kpab_
  • Chain 'C':
    Compound: probable Ubiquitin fold modifier conjugating enzyme
    Species: Leishmania major [TaxId:5664]
    Gene: LmjF15.1250
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4QF57 (Start-167)
      • engineered (159)
    Domains in SCOPe 2.05: d3kpac_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kpaA (A:)
    mahhhhhhmepsvkesvsripllktkagprdgdkwtarlkeeyaslityvehnkasdshw
    fhlesnpqgtrwygtcwtyyknekyefemnfdipvtypqappeialpelegktvkmyrgg
    kicmtthffplwarnvpyfgishvlalglgpwlsievpamveegylkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kpaA (A:)
    svkesvsripllktkagprdgdkwtarlkeeyaslityvehnkasdshwfhlesnpqgtr
    wygtcwtyyknekyefemnfdipvtypqappeialpelegktvkmyrggkicmtthffpl
    warnvpyfgishvlalglgpwlsievpamveegylkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kpaB (B:)
    mahhhhhhmepsvkesvsripllktkagprdgdkwtarlkeeyaslityvehnkasdshw
    fhlesnpqgtrwygtcwtyyknekyefemnfdipvtypqappeialpelegktvkmyrgg
    kicmtthffplwarnvpyfgishvlalglgpwlsievpamveegylkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kpaB (B:)
    svkesvsripllktkagprdgdkwtarlkeeyaslityvehnkasdshwfhlesnpqgtr
    wygtcwtyyknekyefemnfdipvtypqappeialpelegktvkmyrggkicmtthffpl
    warnvpyfgishvlalglgpwlsievpamveegylkp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3kpaC (C:)
    mahhhhhhmepsvkesvsripllktkagprdgdkwtarlkeeyaslityvehnkasdshw
    fhlesnpqgtrwygtcwtyyknekyefemnfdipvtypqappeialpelegktvkmyrgg
    kicmtthffplwarnvpyfgishvlalglgpwlsievpamveegylkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kpaC (C:)
    svkesvsripllktkagprdgdkwtarlkeeyaslityvehnkasdshwfhlesnpqgtr
    wygtcwtyyknekyefemnfdipvtypqappeialpelegktvkmyrggkicmtthffpl
    warnvpyfgishvlalglgpwlsievpamveegylkp