PDB entry 3kov

View 3kov on RCSB PDB site
Description: Structure of MEF2A bound to DNA reveals a completely folded MADS-box/MEF2 domain that recognizes DNA and recruits transcription co-factors
Class: transcription/DNA
Keywords: MADS-box/MEF2 domain, transcription co-factors, protein-DNA complex, protein-protein docking, Acetylation, Activator, Alternative splicing, Apoptosis, Developmental protein, Differentiation, Disease mutation, DNA-binding, Isopeptide bond, Neurogenesis, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Ubl conjugation, TRANSCRIPTION-DNA complex
Deposited on 2009-11-14, released 2010-02-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-03-23, with a file datestamp of 2010-03-19.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.224
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myocyte-specific enhancer factor 2a
    Species: Homo sapiens [TaxId:9606]
    Gene: MEF2A, MEF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3kova_
  • Chain 'B':
    Compound: myocyte-specific enhancer factor 2a
    Species: Homo sapiens [TaxId:9606]
    Gene: MEF2A, MEF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3kovb_
  • Chain 'C':
    Compound: DNA (5'-d(*ap*ap*cp*tp*ap*tp*tp*tp*ap*tp*ap*ap*g)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*cp*tp*tp*ap*tp*ap*ap*ap*tp*ap*gp*t)-3')
  • Chain 'I':
    Compound: myocyte-specific enhancer factor 2a
    Species: Homo sapiens [TaxId:9606]
    Gene: MEF2A, MEF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3kovi_
  • Chain 'J':
    Compound: myocyte-specific enhancer factor 2a
    Species: Homo sapiens [TaxId:9606]
    Gene: MEF2A, MEF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3kovj_
  • Chain 'K':
    Compound: DNA (5'-d(*ap*ap*cp*tp*ap*tp*tp*tp*ap*tp*ap*ap*g)-3')
  • Chain 'L':
    Compound: DNA (5'-d(*tp*cp*tp*tp*ap*tp*ap*ap*ap*tp*ap*gp*t)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kovA (A:)
    grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
    mdkvllkyteynephesrtnsdivealnkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kovB (B:)
    grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
    mdkvllkyteynephesrtnsdivealnkk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kovI (I:)
    grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
    mdkvllkyteynephesrtnsdivealnkk
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kovJ (J:)
    grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
    mdkvllkyteynephesrtnsdivealnkk
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.