PDB entry 3koc

View 3koc on RCSB PDB site
Description: DTD from Plasmodium falciparum in complex with D-Histidine
Class: hydrolase
Keywords: DTD, DEACYLASE, D-HISTIDINE, D-AMINO ACID, Hydrolase
Deposited on 2009-11-13, released 2009-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: dtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3koca_
  • Chain 'B':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: dtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kocb_
  • Chain 'C':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: dtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kocc_
  • Chain 'D':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: dtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kocd_
  • Chain 'E':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: dtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3koce_
  • Chain 'F':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: dtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kocf_
  • Heterogens: DHI

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kocA (A:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kocA (A:)
    mrvviqrvkgailsvrekeleiiseiknglicflgihkndtwedalyiirkclnlrlwnn
    dnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqy
    nddkikigkfgnymnidvtndgpvtiyidthdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kocB (B:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kocB (B:)
    mrvviqrvkgailsvrleiiseiknglicflgihkndtwedalyiirkclnlrlwnndnk
    twdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqyndd
    kikigkfgnymnidvtndgpvtiyidthd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3kocC (C:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kocC (C:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3kocD (D:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kocD (D:)
    mrvviqrvkgailsvreleiiseiknglicflgihkndtwedalyiirkclnlrlwnndn
    ktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqynd
    dkikigkfgnymnidvtndgpvtiyidthd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3kocE (E:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kocE (E:)
    mrvviqrvkgailsveiiseiknglicflgihkndtwedalyiirkclnlrlwnndnktw
    dknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqynddki
    kigkfgnymnidvtndgpvtiyidthd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3kocF (F:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kocF (F:)
    mrvviqrvkgailsvleiiseiknglicflgihkndtwedalyiirkclnlrlwnndnkt
    wdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqynddk
    ikigkfgnymnidvtndgpvtiyidthd